Recombinant Human Hematopoietic progenitor cell antigen CD34 (CD34)

Code CSB-CF004926HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
CD34; Hematopoietic progenitor cell antigen CD34; CD antigen CD34
Species
Homo sapiens (Human)
Expression Region
32-385
Target Protein Sequence
SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Possible adhesion molecule with a role in early hematopoiesis by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. Could act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. Presents carbohydrate ligands to selectins.
Gene References into Functions
  1. This study aimed to confirm and analyze lymphovascular invasion (LVI) detected by hematoxylin and eosin (H and E) using IHC with CD34 and D2-40 and its correlation with other biologic and morphologic prognostic markers. D2-40 is a promising marker for lymphatic endothelium. LVI is a poor prognostic marker hence should be evaluated imperatively in all cases of carcinoma breast. PMID: 29567882
  2. The role of CD34 in determining the premalignant nature of ral submucous fibrosis (OSF) could not be ascertained, since all endothelial cells were positive for CD34, whereas CD105 appeared to be more specific as it is associated with hypoxia-induced angiogenesis which is occurring in OSF due to hyalinization suggesting, CD105 to be more specific marker to determine neoangiogenesis in OSF PMID: 30197335
  3. EZH2, ET-1, and CD34 may act as biomarkers of aggressive cervical squamous cell carcinoma PMID: 29630085
  4. The effects of Platelet-rich plasma on vascular endothelial growth factor receptor-2 (VEGFR2) and CD34 expression were evaluated using real-time PCR, flow cytometry, western blot, immunocytochemistry and pathological study, as were carried out in both human umbilical endothelial cell culture and rat skin PMID: 28948378
  5. Disruption of GFI1B non-DNA-binding zinc-finger 1 is associated with mild to moderate thrombocytopenia without alpha-granule deficiency or bleeding symptomatology, indicating that the site of GFI1B mutation has important phenotypic implications. Platelet CD34 expression appears to be a common feature of perturbed GFI1B function. PMID: 28880435
  6. The endometrial expression of LIF and CD34 in the pathogenesis of non-developing pregnancy can be used for evaluating the pregnancy prognosis in women of young and old reproductive age. PMID: 29063331
  7. In summary, this study shows that CD34 plays a role during cell cycle progression of head and neck squamous cell carcinoma and additionally is involved in irradiation resistance and differentiation of malignant oral keratinocytes. PMID: 27837456
  8. Report CD34 expression in dermatofibromas and dermatofibrosarcoma protuberans. PMID: 28832078
  9. CD34+ clusters showed more important prognostic impact on survival and progression to leukaemia. PMID: 28669578
  10. Our findings showed that increased expression of CD34 and CD117 markers confer tumor progression and aggressiveness on prostate cancer. PMID: 28552539
  11. CD34(+) and CD34(-) cells are different phenotypes of similar cells, and CD34 (1) can be regulated in endothelial colony-forming cells ECFC; (2) is positively involved in capillary-like sprout formation; (3) is associated but not causally related to tip-cell gene expression; and (4) can affect endothelial barrier function. PMID: 27043316
  12. Studied levels of peripheral blood CD34(+ )cells in women who subsequently had a spontaneous miscarriage (SM). Found CD34 positive B cells were significantly lower in SM group compared to control group. PMID: 28110587
  13. The number of platelets and circulating CD34-positive cells acts as an indicator of the activity of the vicious cycle that exists between hypertension and endothelial dysfunction in elderly Japanese men. PMID: 28282559
  14. ESAT-6, an essential virulence factor of Mycobacterium tuberculosis, may contribute to the abnormal hematopoiesis of tuberculosis patients by inhibiting the proliferation and differentiation of CD34-positive hematopoietic cells via apoptosis. PMID: 27745787
  15. Intramyocardial autologous CD34(+) cell administration improved exercise tolerance in patients with refractory angina. PMID: 27491607
  16. Increased gene expression linked to the proinflammatory TGFbeta and MAPK signaling pathways were detected in CD34(+) cells of myeloproliferative neoplasm patients. PMID: 27341002
  17. CD34 stem cell exosomes mediate ischemic tissue repair via beneficial angiogenesis. Exosome-shuttled proangiogenic miRNAs may amplify stem cell function. PMID: 28298297
  18. miR-378 regulates the angiogenic capacity of CD34(+) progenitor cells in STEMI patients. PMID: 28062497
  19. CD34 and IL-8 are associated with poor prognosis of melanoma, metastasis, and neoangiogenesis PMID: 27175552
  20. The results showed that transfection of CD34(+) cells with SiRNA targeting TGF-bRII and their co-culture with human bone marrow mesenchymal stromal cells (MSCs) could considerably increase the number of progenitors PMID: 27344285
  21. Expression of CD34 and MMP-9 accurately predicts clinical behavior detection and prognosis of GCTBs. PMID: 27384731
  22. Expression of VEGF and CD34 was critically correlated with perioperative hemorrhage in gastric cancer patients. PMID: 27503021
  23. There was significant correlation between age and tumor size with CD34 expression in oral SCC samples and no significant correlation between sex and tumor differentiation level. Also, there was no significant correlation between age, sex, tumor size and tumor differentiation level (grading) with CD34 expression in esophagus SCC samples. PMID: 26323448
  24. Normal FLT3 and negative expression of CD34 and cMPL may predict a longer overall survival in aute myeloid leukemia. PMID: 27993871
  25. High VEGF expression was subsequently correlated with a short overall survival rate for patients exhibiting lymph node metastasis (P=0.0128); however, there was no significant difference in overall survival rate regarding the expression levels of TP and CD34 PMID: 26676225
  26. Metformin simultaneously increases VEGFA and reduces CXCL10 and TIMP1 in CD34(+) cells in a model of the diabetic state combined with hypoxia to stimulate angiogenesis. PMID: 26861446
  27. Immunohistochemistry results indicate that combination with ALDH1 and STAT6 can improve the diagnostic value of CD34 for solitary fibrous tumors. PMID: 26617768
  28. CD34(+) cells lowering expression of TET2 may play an oncogenic role on myeloid tumor and CD3(+) T cells of myelodysplastic syndrome patients may be derived from the malignant clone. PMID: 26617797
  29. ICAM-1, VCAM-1 and CD34 are useful biomarkers in evaluation of vascular and inflammatory lesions such as gingival pyogenic granuloma and the results indicate the role of these biomarkers in pathogenesis of oral pyogenic granuloma. PMID: 26625754
  30. Studied the relationship between serum alkaline phosphatase, circulating CD34-positive cells and body mass index. PMID: 26769093
  31. Autophagy in CD34+ cells from aplastic anemia patients is impaired; autophagy is required for the survival of CD34+ cells; impaired autophagy in CD34+ hematopoietic progenitor cells may play an important role in the pathogenesis of aplastic anemia. PMID: 26930650
  32. overexpression in glioma tissues associated closely with higher WHO grade (III + IV) [review] PMID: 26886640
  33. Asthmatics with reduced lung function had a higher frequency of Lin(-) CD34(hi) CD117(int/hi) Fc epsilon RI(+) blood mast cell progenitors than asthmatics with normal lung function. PMID: 26626992
  34. Our results suggest that the CD34/CD25/CD123/CD99(+) LAIP is strictly associated with FLT3-ITD-positive cells. PMID: 25957287
  35. Data indicate only the glycoproteins CD34+/CD71low population showed statistically significant differences between Diamond-Blackfan Anaemia (DBA) patients and controls. PMID: 26394034
  36. We here identify CD49f and CD34 as markers to permit selection of the stem/progenitor cell-like population from human myometrium PMID: 26108791
  37. CD34 expression in the placental endothelial cells was stable throughout pregnancy. PMID: 25043745
  38. Autologous CD 34(+) cell infusion is safe and effectively improves liver function in the short term and may serve as a bridge to liver transplantation. PMID: 26109814
  39. Higher percentages of CD34 + CD38- cells in apheresis products reflect inadequate in vivo purging and reliably distinguish samples enriched in LSCs from those involving mainly normal cells. PMID: 24884314
  40. The number of CD34/144 positive circulating endothelial cells was high in patients with large artery atherosclerosis who experienced chronic ischemic stroke. And this number may reflect severity of carotid atherosclerosis. PMID: 25542764
  41. The evaluation of both CD34-CD105 showed the role of angiogenesis in the cancer proliferation and local spread, the angiogenesis level being maintained high even in the advanced stages of the disease. PMID: 26193208
  42. There were significant differences in CD34 expression between papillary thyroid hyperplasia, papillary thyroid carcinoma, and papillary thyroid lesions of uncertain malignant potential. PMID: 25921136
  43. lack of predictive factors for CD34(+) cells and total nucleated cell concentrations in umbilical cord blood samples before processing PMID: 25446160
  44. The number of CD34(+) cells in bone marrow was significantly higher compared to the number of CD34(+) cells in peripheral blood cells and increased with the acquisition of leukemic cells the resistance to imatinib. PMID: 25804236
  45. CD34 and CD49b are cell surface markers that can be used to enrich a subpopulation of leiomyoma cells possessing stem/progenitor cell properties. PMID: 25658015
  46. no difference in expression between normal and pathologically immature placentas PMID: 25149387
  47. Report CD34/MMP7 expression and invasiveness in early colorectal neoplasms using narrow band imaging and immunohistochemistry. PMID: 25357219
  48. Angiogenic factors VEGF, HIF-1alpha and CD34 are important in breast cancer progression and their abundance in breast tumors has prognostic and predictive value. PMID: 23899963
  49. Combinatorial expression of NKX2-5, SIRPA, VCAM1 and CD34 can be used to define discrete stages of cardiovascular cell lineage differentiation. PMID: 24968096
  50. In MLL-AF4 patients, CD34(+)CD38(+)CD19(+) and CD34(-)CD19(+) cells initiated leukemia. PMID: 25538041

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
CD34 family
Tissue Specificity
Selectively expressed on hematopoietic progenitor cells and the small vessel endothelium of a variety of tissues.
Database Links

HGNC: 1662

OMIM: 142230

KEGG: hsa:947

STRING: 9606.ENSP00000310036

UniGene: Hs.374990

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1