Recombinant Human Killer cell immunoglobulin-like receptor 3DL2 (KIR3DL2)

Code CSB-CF012365HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
KIR3DL2; CD158K; NKAT4; Killer cell immunoglobulin-like receptor 3DL2; CD158 antigen-like family member K; MHC class I NK cell receptor; Natural killer-associated transcript 4; NKAT-4; p70 natural killer cell receptor clone CL-5; p70 NK receptor CL-5; CD antigen CD158k
Species
Homo sapiens (Human)
Expression Region
22-455
Target Protein Sequence
LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLHVLIGTSVVIFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQLDHCVFIQRKISRPSQRPKTPLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor on natural killer (NK) cells and T cells for MHC class I molecules. Upon binding of peptide-free HLA-F open conformer, negatively regulates NK and T cell effector functions. Acts as a receptor on astrocytes for HLA-F. Through interaction with HLA-F, may protect motor neurons from astrocyte-induced toxicity.
Gene References into Functions
  1. We show that KIR3DL2 expression is the most sensitive diagnostic criterion of Sezary syndrome when compared with all other available biological criteria. KIR3DL2 therefore represents a valuable tool for routine use as a clinical parameter at diagnosis, for prognosis and during patient follow-up PMID: 28119365
  2. results identified significant KIR3DL2 expression in all cutaneous T-cell lymphomas subtypes PMID: 29089310
  3. Overexpression of a single MHCI molecule, HLA-F, protects human MNs from ALS astrocyte-mediated toxicity, whereas knockdown of its receptor, the killer cell immunoglobulin-like receptor KIR3DL2, on human astrocytes results in enhanced motor neurons death PMID: 26928464
  4. KIR-3DL2 binding to HLA-B27 licenses Th17 cell differentiation in spondyloarthritis. PMID: 26841353
  5. In early axial spondyloarthritis and ankylosing spondylitis Dutch patients, no copy number changes were found for KIR3DL2. PMID: 25940819
  6. we show that the allele KIR3DL2*001 and the single nucleotide polymorphism 1190T (rs3745902) are associated with differential susceptibility to pemphigus PMID: 25867094
  7. CD158k expression was identified on cutaneous CD4+ T cells in healthy individuals and also mycosis fungoides patients. PMID: 25044837
  8. These findings provide novel insights about the molecular basis of KIR3DL2 binding to B27 PMID: 25582852
  9. these data provide evidence for a possible role of KIR3DL2 in the maintenance of a high circulating malignant-cell burden by preventing activation-induced cell death. PMID: 25414436
  10. Our results indicate that KIR3DL2 can directly promote Sezary syndrome malignant cell death through the use of CpG ODN. PMID: 25007046
  11. our results show that a multistep gating of CD158k+ cells is reliable to assess tumor burden in case of Sezary syndrome. PMID: 25158034
  12. our results offer preclinical proof of concept for the clinical development of IPH4102, a humanized monoclonal antibody that targets the immune receptor KIR3DL2,to treat patients with nced cutaneous T-cell lymphoma PMID: 25361998
  13. KIR3DL2 binds to HLA-B27 dimers and free H chains more strongly than other HLA class I and promotes the expansion of T cells in ankylosing spondylitis. PMID: 23440420
  14. PLS3, Twist, KIR3DL2 and NKp46 gene expression can model efficient molecular Sezary syndrome diagnosis. PMID: 23429988
  15. most frequently expressed KIR receptor in transformed mycosis fungoides PMID: 22621189
  16. results suggest that carriers of A allele in exon 3 of killer cell immunoglobulin-like receptor 3DL2(KIR3DL2) have a decreased susceptibility to preeclampsia PMID: 21406041
  17. Enhanced proliferation, survival, and interleukin (IL)-17 production of KIR3DL2+ CD4 T cells stimulated with antigen-presenting cells expressing HLA-B27 homodimers suggest new therapeutic strategies in ankylosing spondylitis. PMID: 21248258
  18. Data show direct binding of KIR3DL2 to ODNs and we show that the D0 domain is involved primarily in this interaction. PMID: 20147700
  19. The A52G polymorphism in exon 3 and the frequencies of C32T in exon 9 of KIR3DL2 gene polymorphism are associated with the pathogenesis of pre-eclampsia. PMID: 19953898
  20. All genotypes seen included genes for KIR3DL2. PMID: 12559621
  21. IR3DL2/p140 engagement does not result into inhibitory (nor activatory) effects on tumor-specific cytotoxic T lymphocytes. PMID: 14562047
  22. A high level of KIR3DL2 allelic polymorphism has been identified. PMID: 15304002
  23. Receptor is a marker for the diagnosis of Sezary syndrome. PMID: 16962036
  24. Five new alleles are reported, and four previously known ones are confirmed. PMID: 17661911
  25. observation that CD4 positive, CD7 negative T-cells are mostly CD158k negative suggests that CD158k may be able to help identify and enumerate neoplastic T-cells in Sezary syndrome PMID: 18061949
  26. Functional analysis of KIR3DL2-single positive natural killer (NK) cells reveals a subset that is hyporesponsive in individuals harboring cognate ligands HLA-A3/A11. PMID: 18941190
  27. Anti-p140 autoantibodies represent a major autoantibody subset in juvenile dermatomyositis. PMID: 19479859
  28. Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia. PMID: 19165527

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Immunoglobulin superfamily
Tissue Specificity
Expressed in astrocytes.
Database Links

HGNC: 6339

OMIM: 604947

KEGG: hsa:3812

STRING: 9606.ENSP00000325525

UniGene: Hs.645228

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1