Recombinant Human Killer cell immunoglobulin-like receptor 3DL2(KIR3DL2)

Code CSB-CF012365HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P43630
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLHVLIGTSVVIFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQLDHCVFIQRKISRPSQRPKTPLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF
Source in vitro E.coli expression system
Gene Names KIR3DL2
Protein Names Recommended name: Killer cell immunoglobulin-like receptor 3DL2 Alternative name(s): CD158 antigen-like family member K MHC class I NK cell receptor Natural killer-associated transcript 4 Short name= NKAT-4 p70 natural killer cell receptor cl
Expression Region 22-455
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor on natural killer (NK) cells for HLA-A alleles. Inhibits the activity of NK cells thus preventing cell lysis.
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Immunoglobulin superfamily
Database Links

HGNC: 6339

OMIM: 604947

KEGG: hsa:3812

STRING: 9606.ENSP00000325525

UniGene: Hs.645228

Pathway Antigen processing and presentation
Natural killer cell mediated cytotoxicity

Related Products

KIR3DL2 Antibodies

KIR3DL2 Antibodies for Homo sapiens (Human)

KIR3DL2 Antibodies for Human

KIR3DL2 Proteins

KIR3DL2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.