Recombinant Human Kit ligand(KITLG)

Code CSB-CF012376HU(A4)
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P21583
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAVENIQINEEDNEISMLQEKEREFQEV
Source in vitro E.coli expression system
Gene Names KITLG
Protein Names Recommended name: Kit ligandAlternative name(s): Mast cell growth factor Short name= MGF Stem cell factor Short name= SCF c-Kit ligandCleaved into the following chain: 1. Soluble KIT ligand Short name= 2. sKITLG
Expression Region 26-273
Tag Info 10xHis-SUMO-tag
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.
Involvement in disease Hyperpigmentation with or without hypopigmentation, familial progressive (FPHH); Deafness, congenital, unilateral or asymmetric (DCUA)
Subcellular Location Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, Cytoplasm, cytoskeleton, Cell membrane, Single-pass type I membrane protein, Cell projection, lamellipodium, Cell projection, filopodium, SUBCELLULAR LOCATION: Soluble KIT ligand: Secreted
Protein Families SCF family
Database Links

HGNC: 6343

OMIM: 145250

KEGG: hsa:4254

STRING: 9606.ENSP00000228280

UniGene: Hs.1048

Pathway MAPK signaling pathway
Melanogenesis
PI3K-Akt signaling pathway
Ras signaling pathway
Fc gamma R-mediated phagocytosis
Phospholipase D signaling pathway
Rap1 signaling pathway

Related Products

KITLG Antibodies

KITLG Antibodies for Human

KITLG Antibodies for Homo sapiens (Human)

KITLG Proteins

KITLG Proteins for Homo sapiens (Human)

KITLG ELISA Kit

KITLG ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.