Recombinant Human Kynurenine 3-monooxygenase (KMO)

Code CSB-CF012475HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
KMO
Uniprot No.
Alternative Names
dJ317G22.1; kmo; KMO_HUMAN; Kynurenine 3 hydroxylase; Kynurenine 3 monooxygenase (kynurenine 3 hydroxylase); Kynurenine 3 monooxygenase; Kynurenine 3-hydroxylase; Kynurenine 3-monooxygenase; RP1-317G22.1
Species
Homo sapiens (Human)
Expression Region
1-486
Target Protein Sequence
MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQIDVYEAREDTRVATFTRGRSINLALSH RGRQALKAVGLEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLT AAEKYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKK PRFDYSQQYIPHGYMELTIPPKNGDYAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMP FEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCV LLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDHAISDLS MYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKK VINKGLFFLGSLIAISSTYLLIHYMSPRSFLRLRRPWNWIAHFRNTTCFPAKAVDSLEQI SNLISR
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the hydroxylation of L-kynurenine (L-Kyn) to form 3-hydroxy-L-kynurenine (L-3OHKyn). Required for synthesis of quinolinic acid, a neurotoxic NMDA receptor antagonist and potential endogenous inhibitor of NMDA receptor signaling in axonal targeting, synaptogenesis and apoptosis during brain development. Quinolinic acid may also affect NMDA receptor signaling in pancreatic beta cells, osteoblasts, myocardial cells, and the gastrointestinal tract (Probable).
Gene References into Functions
  1. There is the association between the rs1053230 polymorphism and depression. PMID: 28139632
  2. results show the incidence of Postpartum Depression in the Chinese population to be 7.3%, with PDS characterized by increased serum 3-HydroxyKinurenine concentration and 3-HK/Kynurenine ratio, versus matched postpartum women without PDS. Furthermore, polymorphisms of Kynurenine Monooxygenase rs1053230 are significantly associated with the incidence of PDS. PMID: 28319697
  3. Our data establish the candidacy of KMO as a causal factor for changes in the kidney leading to proteinuria and indicate a functional role for KMO and metabolites of the tryptophan pathway in podocytes PMID: 27020856
  4. A comprehensive review of the molecular properties of KMO, including its kinetics, reaction mechanism, and inhibitor structure-activity relationship (SAR), is not currently available and, thus, is our focus here PMID: 26589832
  5. SiRNA knockdown of the pathway components Kynurenine 3-monooxygenase and quinolinate phosphoribosyl transferase caused cells to revert to a state of susceptibility to 3HK-mediated apoptosis. PMID: 27077813
  6. These results suggest that KMO exhibits tumor-promoting effects towards hepatocellular carcinoma (HCC) and it may serve as a novel prognostic marker in HCC. PMID: 26099564
  7. Results suggest that KMO variation influences a range of cognitive domains known to predict functional outcome in schizophrenia PMID: 25464917
  8. Two KMO SNPs were observed more often in schizophrenia patient group compared with healthy controls. PMID: 25715464
  9. findings from five independent cohorts suggest that genetic variation in KMO influences the risk for psychotic features in mania of bipolar disorder patients. PMID: 23459468
  10. Study reporting on the first successful bacterial (Escherichia coli) expression of active FLAGtrade mark-tagged human KMO enzyme expressed in the soluble fraction and progress towards its purification. PMID: 24316190
  11. analyzed association between KMO gene polymorphisms and CSF concentrations of kynurenic acid in patients with schizophrenia and controls. results suggest that the nonsynonymous KMO SNP rs1053230 influences CSF concentrations of KYNA. PMID: 21693093
  12. significant and correlated reduction in gene expression and enzyme activity in the frontal eye field in schizophrenia patients; rs2275163 has modest effects on predictive pursuit and visuospatial working memory endophenotypes PMID: 21727251
  13. The present analysis of the combined Scandinavian sample did not reveal any allele frequency difference between patients and healthy controls PMID: 21030213
  14. the function KMO AND indoleamine 2,3-dioxygenase may change from a role in immunosuppression at the maternal-fetal interface in early pregnancy, to one associated with regulation of fetoplacental blood flow or placental metabolism in late gestation PMID: 15950064
  15. Results suggest that kynurenine 3-monooxygenase is unlikely to be related to the development of schizophrenia in Japanese. PMID: 16716206

Show More

Hide All

Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.
Protein Families
Aromatic-ring hydroxylase family, KMO subfamily
Tissue Specificity
Highest levels in placenta and liver. Detectable in kidney.
Database Links

HGNC: 6381

OMIM: 603538

KEGG: hsa:8564

STRING: 9606.ENSP00000355517

UniGene: Hs.731056

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×