Recombinant Human Pituitary adenylate cyclase-activating polypeptide type I receptor (ADCYAP1R1)

Code CSB-CF001347HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
ADCYAP1R1; Pituitary adenylate cyclase-activating polypeptide type I receptor; PACAP type I receptor; PACAP-R-1; PACAP-R1
Species
Homo sapiens (Human)
Expression Region
21-468
Target Protein Sequence
MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPEL FRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDEYE SETGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRA ISVFIKDWILYAEQDSNHCFISTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFF PERRYFYWYTIIGWGTPTVCVTVWATLRLYFDDTGCWDMNDSTALWWVIKGPVVGSIMVN FVLFIGIIVILVQKLQSPDMGGNESSIYLRLARSTLLLIPLFGIHYTVFAFSPENVSKRE RLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKVNRYFAVDFKHRHPSLASSGV NGGTQLSILSKSSSQIRMSGLPADNLAT
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is a receptor for PACAP-27 and PACAP-38. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. May regulate the release of adrenocorticotropin, luteinizing hormone, growth hormone, prolactin, epinephrine, and catecholamine. May play a role in spermatogenesis and sperm motility. Causes smooth muscle relaxation and secretion in the gastrointestinal tract.
Gene References into Functions
  1. These results show that b-arrestin1 and b-arrestin2 exert differential actions on PAC1R internalization and PAC1R-dependent ERK1/2 activation, and suggest that the two b-arrestin isoforms may be involved in fine and precise tuning of the PAC1R signaling pathways. PMID: 29734363
  2. Studies suggest that the level of stress and circulating gonadal hormones may differentially regulate the PACAPergic system in males and females to influence anxiety-like behavior and may be one mechanism underlying the discrepancies in human psychiatric disorders. [Review Article] PMID: 28610473
  3. These results provide evidence for an association between ADCYAP1R1 and PTSD and indicate that there may indeed be sex differences. PMID: 28746747
  4. These findings lead to a model in which E2 induces the expression of ADCYAP1R1 through binding of ERalpha at the ERE as an adaptive response to stress. Inhibition of E2/ERalpha binding to the ERE containing the rs2267735 risk allele results in reduced expression of ADCYAP1R1, diminishing estrogen regulation as an adaptive stress response and increasing risk for PTSD. PMID: 27959335
  5. Data suggest that GCGR (glucagon receptor) activation proceeds via a mechanism in which transmembrane helix 6 (TM6) is held in an inactive conformation by a conserved polar core and a hydrophobic lock (involving intracellular loop 3, IC3); mutations in the corresponding polar core of GCGR or PAC1R disrupt these inhibitory elements, allow TM6 to swing outward, and induce constitutive G protein signaling. PMID: 28356352
  6. Results confirmed for the first time that doxycycline specially targeted pituitary adenylate cyclase-activating polypeptide (PACAP) receptor type 1 (PAC1) imitating PACAP(30-37) and acted as an enhancer by facilitating the subsequent ligand binding and the activation of PAC1. PMID: 26700245
  7. Rsults suggest that impaired contextual conditioning in the hippocampal formation may mediate the association between type I receptor of the pituitary adenylate cyclase activating polypeptideand and posttraumatic stress disorder symptoms. PMID: 25680674
  8. Data show that glucocorticoid response genes NR3C1, ADCYAP1R1 and HSD11B2 were relatively hypomethylated whereas FKBP5 was hypermethylated. PMID: 26343289
  9. Further investigations of genetic factors for trauma-related psychopathology should include careful assessments of the social environment PMID: 26334183
  10. High child stress and an ADCYAP1R1 single-nucleotide polymorphism are associated with reduced bronchodilator response in children with asthma. PMID: 25918834
  11. and its receptor (PAC1) are involved in stress response and anxiety. PMID: 23972788
  12. association of variants with sudden infant death not supported PMID: 23981011
  13. PAC1/PACAP receptor endocytosis contributes to ERK acktivation. PMID: 24696141
  14. This review focuses on role of PAC1 receptor in brain development, behavior of transgenic animals and potential implication in human neurodevelopmental disorders. PMID: 24220567
  15. PAC1 receptor (ADCYAP1R1) genotype is associated with dark-enhanced startle in both male and female children. PMID: 22776899
  16. Individual differences in ADCYAP1R1 genotype may contribute to dysregulated fear circuitry known to play a central role in posttraumatic stress disorder and other anxiety disorders. PMID: 24516127
  17. Data indicate that VIP and PACAP increased macrophage resistance to HIV-1 replication by inducing the synthesis of beta-chemokines CCL3 and CCL5 and IL-10 following preferential activation of the receptors VPAC2 and PAC1. PMID: 23818986
  18. The findings suggest that the PACAP-PAC1 receptor pathway may play an important role in female human responses to traumatic stress PMID: 23394710
  19. ADCYAP1R1 genotype may have a role in post-traumatic stress symptoms in highly traumatized African-American females PMID: 23505260
  20. Genetic variation at the ADCYAP1R1 locus interacts with child abuse to shape risk of later posttraumatic stress disorder (PTSD) in women. PMID: 23280952
  21. Epigenetic and genetic variants in ADVYAP1R1 are associated with asthma in Puerto Rican children. PMID: 23328528
  22. [review] The Adcyap1r1 receptor single nucleotide polymorphism (SNP) is located within a predicted estrogen response element (ERE). PMID: 23147486
  23. Conclude that VPAC2/PAC1 receptors require NO in series to effect cutaneous active vasodilation during heat stress in humans. PMID: 22961270
  24. The increased expressions of PAC1 receptors on lactating breast may indicate a PACAP38/PAC1 interaction in the mammary gland during lactation. PMID: 22539193
  25. PAC1 regulates PYK-2 tyrosine phosphorylation in a calcium-dependent manner in lung cancer cell lines. PMID: 22581436
  26. Activation of Sp1 by the Ras/MAPK pathway might participate in neuron specific expression of the PAC1 gene. PMID: 22609358
  27. A reported association between rs2267735 and PTSD could not be replicated in either African American or European American females in two large independent samples. PMID: 21912390
  28. The present study constitutes the first characterization of the binding domains of PACAP to its specific receptor PAC1 and suggests heterogeneity within the binding mode of peptide ligands to class B GPCRs. PMID: 21185349
  29. VPAC2 and/or PAC1 receptor activation is involved in cutaneous active vasodilation in humans. PMID: 20395540
  30. Results indicate that VPAC1, but not VPAC2 or PAC1, up-regulation in macrophages is a common mechanism in response to acute and chronic pro-inflammatory stimuli. PMID: 20026142
  31. PACAP receptor type 1 mRNA is expressed in the trigeminal, otic and superior cervical ganglia (prejunctional) and cerebral arteries (postjunctional). PMID: 11930171
  32. HCT8 human colon tumor cells express PAC1, and PAC1 activation is coupled to adenylate cyclase, increase cytosolic [Ca(2+)](i), and cellular proliferation PMID: 12409223
  33. Using GST pull-down assay, ARF6 binds to the hop1 but not the null domain of PAC1 receptor PMID: 12409233
  34. receptors were positively coupled to adenylyl cyclase in human lung cancer, but the enzyme activity was impaired as compared to normal lung PMID: 12732341
  35. Expression of functional PAC(1), VPAC(1) and VPAC(2) receptors in human prostate as well as its maintenance after malignant transformation PMID: 12948842
  36. In colon cancer cell lines, PAC1 is expressed as the SV1 or HIP splice variant and is coupled to the activation only of cAMP but not of intracellular Ca2+. PMID: 14742913
  37. PAC(1)-R null variant is the most relevant isoform expressed in human prostaste cancer, and may be related with the events determining the outcome of prostate cancer. PMID: 16372333
  38. Stimulation of endogenously expressed PAC1 receptors with PACAP in human neuroblastoma cells increased APPsalpha secretion. PAC1R activation stimulates ERK phosphorylation. PMID: 16401644
  39. PAC1-R is the predominant PACAP receptor found in fetuses, and both PAC1-R and VPAC1-R are expressed in the mature cerebellum. PMID: 16572459
  40. Data demonstrate that altered neuronal proliferation/apoptosis and disrupted ependymal cilia are the main factors contributing to hydrocephalus in PAC1-overexpressing mice. PMID: 16823490
  41. PACAP may regulate the biological release of peptides and serotonin from BON cells PMID: 16888199

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family
Tissue Specificity
Most abundant in the brain, low expression in the lung, liver, thymus, spleen, pancreas and placenta.
Database Links

HGNC: 242

OMIM: 102981

KEGG: hsa:117

UniGene: Hs.377783

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1