Recombinant Human Receptor activity-modifying protein 1(RAMP1)

Code CSB-CF019304HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O60894
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence CQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV
Source in vitro E.coli expression system
Gene Names RAMP1
Protein Names Recommended name: Receptor activity-modifying protein 1 Alternative name(s): Calcitonin-receptor-like receptor activity-modifying protein 1 Short name= CRLR activity-modifying protein 1
Expression Region 27-148
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane. Acts as a receptor for calcitonin-gene-related peptide (CGRP) together with CALCRL.
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families RAMP family
Tissue Specificity Expressed in many tissues including the uterus, bladder, brain, pancreas and gastro-intestinal tract.
Database Links

HGNC: 9843

OMIM: 605153

KEGG: hsa:10267

STRING: 9606.ENSP00000254661

UniGene: Hs.471783

Pathway Vascular smooth muscle contraction

Related Products

RAMP1 Antibodies

RAMP1 Antibodies for Homo sapiens (Human)

RAMP1 Proteins

RAMP1 Proteins for Homo sapiens (Human)

RAMP1 ELISA Kit

RAMP1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.