Recombinant Human Receptor activity-modifying protein 1 (RAMP1)

Code CSB-CF019304HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
RAMP1; Receptor activity-modifying protein 1; Calcitonin-receptor-like receptor activity-modifying protein 1; CRLR activity-modifying protein 1
Species
Homo sapiens (Human)
Expression Region
27-148
Target Protein Sequence
CQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane. Acts as a receptor for calcitonin-gene-related peptide (CGRP) together with CALCRL.
Gene References into Functions
  1. T-A-T RAMP1 gene haplotype might have utility as a genetic marker for Essential Hypertension and that the RAMP1 gene may be associated with increased susceptibility to Essential Hypertension in a Japanese population. PMID: 28181496
  2. Evidence that DNA methylation at RAMP1 gene promoter plays a role in migraine was described. PMID: 26501962
  3. RAMP1 rs7590387 has a role in the transformation of episodic migraine into medication overuse headache. PMID: 25881990
  4. A novel functional role for RAMP1 in regulation of CaSR signalling in addition to its known role in receptor trafficking, is reported. PMID: 24454825
  5. multiple NKX3.1 binding sites were found in the RAMP1 locus in human prostate cancer cells and in the normal mouse prostate. PMID: 23867798
  6. RAMP1 overexpression enhances the promoting effect that exogenous CGRP has on osteogenic differentiation PMID: 22949393
  7. No significant association of the tested SNPs of the RAMP1 gene were found with migraine susceptibility. PMID: 23237777
  8. CLR and RAMP1 co-localize in the enteric nervous system of human stomach, ileum, and colon, and are in close proximity to their ligands CGRP and IMD PMID: 22484227
  9. The present finding demonstrated that RAMP1 immunoreactivity was localized in many neurons and phenopalatine ganglion. PMID: 22208649
  10. lower expression in bronchial biopsies from subjects with asthma PMID: 20933260
  11. The T-A-C haplotype is a genetic marker for cerebral infarction, and RAMP1 is associated with increased susceptibility to cerebral infarction. PMID: 19710695
  12. These data for the first time pinpoint a specific RAMP1 residue important for both antagonist and agonist potency and are consistent with the N-terminal domain of RAMP1 forming the binding pocket interface with calcitonin receptor-like receptor. PMID: 20188075
  13. RAMP1 overexpression attenuates Ang-II-induced hypertension and induces a protective change in cardiovascular autonomic regulation PMID: 20100989
  14. Co-expression of RAMP1 and CRLR reconstituted a CGRP receptor that was able to activate the pheromone-signaling pathway with pharmacological properties similar to those observed previously in mammalian cells. PMID: 11733510
  15. Receptor activity-modifying protein 1 determines the species selectivity of non-peptide CGRP receptor antagonists. PMID: 11847213
  16. The extracellular domain of receptor activity-modifying protein 1 is sufficient for calcitonin receptor-like receptor function PMID: 12574158
  17. identification of domains responsible for agonist binding specificity PMID: 12684503
  18. TNF-alpha induced time- and dose-dependent decreases in the expression of RAMP1 mRNA in cultured human coronary artery smooth muscle cells, thereby diminishing AM-evoked cAMP production PMID: 15245870
  19. calcitonin receptor-like receptor heterodimer with RAMP1 yields a calcitonin gene-related peptide receptor PMID: 15613468
  20. RAMP1 interacts with tubulin. PMID: 17493758
  21. Functional calcitonin gene-related peptide receptors are formed by the asymmetric assembly of a calcitonin receptor-like receptor and RAMP1. PMID: 17785463
  22. We did not observe any difference in mRNA for CL-R and RAMPs in arteries from patients with hemorrhagic stroke, arteriosclerosis and acute myocardial infarction when compared to patients without these diagnoses PMID: 18198792
  23. RAMP1 may be strongly considered as a candidate gene for migraine. PMID: 18240900
  24. Identification of RAMP1 residues important for calcitonin gene-related peptide are reported. PMID: 18593822
  25. the crystal structure of the extracellular domain of human RAMP1 at 2.4 A resolution was determined. PMID: 18725456

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
RAMP family
Tissue Specificity
Expressed in many tissues including the uterus, bladder, brain, pancreas and gastro-intestinal tract.
Database Links

HGNC: 9843

OMIM: 605153

KEGG: hsa:10267

STRING: 9606.ENSP00000254661

UniGene: Hs.471783

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1