Recombinant Human Receptor activity-modifying protein 2(RAMP2)

Code CSB-CF019305HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O60895
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence QPLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDPPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA
Source in vitro E.coli expression system
Gene Names RAMP2
Protein Names Recommended name: Receptor activity-modifying protein 2 Alternative name(s): Calcitonin-receptor-like receptor activity-modifying protein 2 Short name= CRLR activity-modifying protein 2
Expression Region 43-175
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane. Acts as a receptor for adrenomedullin (AM) together with CALCRL.
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families RAMP family
Tissue Specificity Strongly expressed in lung, breast, immune system and fetal tissues.
Database Links

HGNC: 9844

OMIM: 605154

KEGG: hsa:10266

STRING: 9606.ENSP00000253796

UniGene: Hs.514193

Pathway Vascular smooth muscle contraction

Related Products

RAMP2 Antibodies

RAMP2 Antibodies for Homo sapiens (Human)

RAMP2 Antibodies for Human

RAMP2 Proteins

RAMP2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.