Recombinant Human Receptor activity-modifying protein 3 (RAMP3)

Code CSB-CF019306HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
RAMP3
Uniprot No.
Alternative Names
RAMP3; Receptor activity-modifying protein 3; Calcitonin-receptor-like receptor activity-modifying protein 3; CRLR activity-modifying protein 3
Species
Homo sapiens (Human)
Expression Region
24-148
Target Protein Sequence
RAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) and GPER1 to the plasma membrane. Acts as a receptor for adrenomedullin (AM) together with CALCRL.
Gene References into Functions
  1. The expression of RAMP3 is downregulated in the fetal lung with increasing gestational age. PMID: 24169318
  2. the RAMP3 TMD participates in the negative regulation of CLR/RAMP3 internalization. PMID: 22445753
  3. Data show that LOXL2 and RAMP3 are strongly coexpressed in human colon, breast, and gastric carcinomas but not in normal colon or gastric epithelial cells. PMID: 20802105
  4. This study provides insight into the role of three amino acid changes in human RAMP3. PMID: 20034525
  5. Morphological fluorescence techniques, bioluminescence resonance energy transfer, and bimolecular fluorescence complementation analysis demonstrate that the secretin receptor associates specifically with RAMP3, but not with RAMP1 or RAMP2. PMID: 19886671
  6. RAMP3 interacts with N-ethylmaleimide-sensitive factor to cause the change in trafficking PMID: 15613468
  7. results, using both endogenous and overexpressed cellular models, indicate a novel function for NHERF-1 and RAMP3 in the internalization of the adrenomedullin receptor and suggest additional regulatory mechanisms for receptor trafficking PMID: 15805108
  8. Identification of RAMP3 residues for adrenomedjullin receptors are reported. PMID: 18593822

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Membrane; Single-pass type I membrane protein. Note=Moves from intracellular puncta to the plasma membrane in a RAMP3-dependent manner.
Protein Families
RAMP family
Tissue Specificity
Strongly expressed in lung, breast, immune system and fetal tissues.
Database Links

HGNC: 9845

OMIM: 605155

KEGG: hsa:10268

STRING: 9606.ENSP00000242249

UniGene: Hs.25691

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1