Name: Recombinant Human Sodium/potassium-transporting ATPase subunit gamma(FXYD2)
Brand: CUSABIO
SKU: CSB-CF009090HU

Product Details

Target Names	FXYD2
Uniprot No.	P54710
Alternative Names	FXYD2; ATP1C; ATP1G1; Sodium/potassium-transporting ATPase subunit gamma; Na(+)/K(+) ATPase subunit gamma; FXYD domain-containing ion transport regulator 2; Sodium pump gamma chain
Species	Homo sapiens (Human)
Expression Region	1-66
Target Protein Sequence	MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP
Protein Length	full length protein
Tag Info	The following tags are available. The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form	Lyophilized powder
Buffer before Lyophilization	Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet	Please contact us to get it.

Target Data

Function	May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase.
Gene References into Functions	FXYD2 is functionally upregulated in ovarian clear cell carcinoma and may serve as a promising prognostic biomarker and therapeutic target of cardiac glycosides in OCCC PMID: 26910837 Recurrent FXYD2 p.Gly41Arg mutation is associated with isolated dominant hypomagnesaemia. PMID: 25765846 FXYD2b could regulate the Na,K-ATPase by modulating the effective membrane surface electrostatics near the ion binding sites of the pump. PMID: 24794573 our findings suggested that FXYD2c played a role in regulation of NKA activity by enhancing the expression of NKA in HK-2 cells upon hypertonic challenge. PMID: 24258619 PCBD1 (dimerization cofactor of HNF-1alpha) is coactivator of the HNF1B-mediated transcription necessary for fine tuning ATPase Na+/K+ transporting gamma 1 polypeptide (FXYD2) transcription in the distal convoluted tubule. PMID: 24204001 This is the first report demonstrating the potential utility of FXYD2 immunohistochemistry in the diagnosis of chromophobe renal cell carcinoma PMID: 23196795 findings confirm the presence of an FXYD2 peptide in the crab gill Na,K-ATPase and demonstrate that this peptide plays an important role in regulating enzyme activity PMID: 22588134 wild type HNF1B specifically induces FXYD2A transcription whereas all HNF1B mutants partially prevented it. PMID: 21130072 Datab propose human FXYD2gammaa as a novel beta cell-specific biomarker. PMID: 20379810 Study reveals, in various human tissues, the specific expression of FXYD2, which may associate with Na, K-ATPase in selected cell types and modulate its catalytic properties. PMID: 19879113 the TM domain of FYXD2 effects the shift in apparent Na+ affinity PMID: 12907667 Activity of GLAST directs FXYD2 protein/gamma subunit to the cell surface, that leads to the activation of the astroglial sodium pump. PMID: 17316900 structures of the FXYD proteins (with emphasis on 1-4), as well as their dynamics and their associations with the lipid PMID: 18000745 results suggest that FXYD2 can mediate basolateral extrusion of magnesium from cultured renal epithelial cells and provide new insights into the understanding of the possible physiological roles of FXYD2 wild-type and mutant proteins. PMID: 18448590 Expression in transfectants reduces Na+ and K+ affinity of Na,K-ATPase. Endogenous expression in certain nephron segments correlates with low Na+ affinity in Na,K-ATPase. PMID: 10559186 Show More Hide All
Involvement in disease	Hypomagnesemia 2 (HOMG2)
Subcellular Location	Membrane, Single-pass type III membrane protein
Protein Families	FXYD family
Tissue Specificity	Expressed in the distal convoluted tubule in the kidney. Found on basolateral membranes of nephron epithelial cells.
Database Links	HGNC: 4026 OMIM: 154020 KEGG: hsa:486 STRING: 9606.ENSP00000292079 UniGene: Hs.731865

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-CF009090HU
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Sodium/potassium-transporting ATPase subunit gamma(FXYD2)

Product Details

Related Products

Target Data

CloseMessage

×CloseMessage