Recombinant Human Sodium/potassium-transporting ATPase subunit gamma(FXYD2)

Code CSB-CF009090HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P54710
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP
Source in vitro E.coli expression system
Gene Names FXYD2
Protein Names Recommended name: Sodium/potassium-transporting ATPase subunit gamma Short name= Na(+)/K(+) ATPase subunit gammaAlternative name(s): FXYD domain-containing ion transport regulator 2 Sodium pump gamma chain
Expression Region 1-66
Tag Info 10xHis-SUMO-tag
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase.
Involvement in disease Hypomagnesemia 2 (HOMG2)
Subcellular Location Membrane, Single-pass type III membrane protein
Protein Families FXYD family
Tissue Specificity Expressed in the distal convoluted tubule in the kidney. Found on basolateral membranes of nephron epithelial cells.
Database Links

HGNC: 4026

OMIM: 154020

KEGG: hsa:486

STRING: 9606.ENSP00000292079

UniGene: Hs.731865

Pathway cAMP signaling pathway
Cardiac muscle contraction
Th17 cell differentiation
Thyroid hormone synthesis
cGMP-PKG signaling pathway

Related Products

FXYD2 Antibodies

FXYD2 Antibodies for Homo sapiens (Human)

FXYD2 Antibodies for Human

FXYD2 Proteins

FXYD2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.