Code | CSB-CF009090HU |
Size | Pls inquire other sizes |
Source | in vitro E.coli expression system |
Target Names | FXYD2 |
Uniprot No. | P54710 |
Species | Homo sapiens (Human) |
Expression Region | 1-66 |
Target Protein Sequence | MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP |
Protein Length | full length protein |
Tag Info | The following tags are available. 10xHis-SUMO-tag The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
|
Form | Lyophilized powder |
Buffer before Lyophilization | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet | Please contact us to get it. |
Still Have Questions? | Start a Chat |
Function | May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase. |
Involvement in disease | Hypomagnesemia 2 (HOMG2) |
Subcellular Location | Membrane, Single-pass type III membrane protein |
Protein Families | FXYD family |
Tissue Specificity | Expressed in the distal convoluted tubule in the kidney. Found on basolateral membranes of nephron epithelial cells. |
Database Links |
HGNC: 4026 OMIM: 154020 KEGG: hsa:486 STRING: 9606.ENSP00000292079 UniGene: Hs.731865 |
Recombinant Human Melanoma-associated antigen 1(MAGEA1)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Bovine Beta-1,4-galactosyltransferase 1(B4GALT1),partial
Express system: Yeast
Species: Bos taurus (Bovine)
Recombinant Human Integrin alpha-IIb(ITGA2B),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Apoptosis regulatory protein Siva(SIVA1)
Express system: E.coli
Species: Homo sapiens (Human)
Tel: 301-363-4651
Email: support@cusabio.com
Distributors Worldwide