Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF009090HU |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | P54710 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Homo sapiens (Human) |
| Sequence | MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP |
| Source | in vitro E.coli expression system |
| Gene Names | FXYD2 |
| Protein Names | Recommended name: Sodium/potassium-transporting ATPase subunit gamma Short name= Na(+)/K(+) ATPase subunit gammaAlternative name(s): FXYD domain-containing ion transport regulator 2 Sodium pump gamma chain |
| Expression Region | 1-66 |
| Tag Info | 10xHis-SUMO-tag |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase. |
| Involvement in disease | Hypomagnesemia 2 (HOMG2) |
| Subcellular Location | Membrane, Single-pass type III membrane protein |
| Protein Families | FXYD family |
| Tissue Specificity | Expressed in the distal convoluted tubule in the kidney. Found on basolateral membranes of nephron epithelial cells. |
| Database Links |
HGNC: 4026 OMIM: 154020 KEGG: hsa:486 STRING: 9606.ENSP00000292079 UniGene: Hs.731865 |
| Pathway |
cAMP signaling pathway
Cardiac muscle contraction Th17 cell differentiation Thyroid hormone synthesis cGMP-PKG signaling pathway |
FXYD2 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA009090GA01HU | FXYD2 Antibody | Human,Mouse,Rat | ELISA,WB,IHC |
FXYD2 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA009090ESR1HU | FXYD2 Antibody | Human | ELISA, IHC |
FXYD2 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-EP009090HU | Recombinant Human Sodium/potassium-transporting ATPase subunit gamma(FXYD2) | E.coli |
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-1 alpha(IL1A)
Express system: E.coli
Species: Macaca mulatta (Rhesus macaque)
Recombinant Human CCAAT/enhancer-binding protein gamma(CEBPG)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Cleavage and polyadenylation specificity factor subunit 4(CPSF)
Express system: E.coli
Species: Homo sapiens (Human)
