Recombinant Human Somatostatin receptor type 3 (SSTR3)

Code CSB-CF022726HU
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
SSTR3
Uniprot No.
Alternative Names
SSTR3; Somatostatin receptor type 3; SS-3-R; SS3-R; SS3R; SSR-28
Species
Homo sapiens (Human)
Expression Region
1-418
Target Protein Sequence
MDMLHPSSVSTTSEPENASSAWPPDATLGNVSAGPSPAGLAVSGVLIPLVYLVVCVVGLL GNSLVIYVVLRHTASPSVTNVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLVM AVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVVV FSGVPRGMSTCHMQWPEPAAAWRAGFIIYTAALGFFGPLLVICLCYLLIVVKVRSAGRRV WAPSCQRRRRSERRVTRMVVAVVALFVLCWMPFYVLNIVNVVCPLPEEPAFFGLYFLVVA LPYANSCANPILYGFLSYRFKQGFRRVLLRPSRRVRSQEPTVGPPEKTEEEDEEEEDGEE SREGGKGKEMNGRVSQITQPGTSGQERPPSRVASKEQQLLPQEASTGEKSSTMRISYL
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for somatostatin-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase.
Gene References into Functions
  1. the C-terminal phosphorylation motif of the human sst3 receptor that regulates its agonist-promoted phosphorylation, beta-arrestin recruitment, and internalization of this clinically relevant receptor, is reported. PMID: 27101376
  2. findings provide new insights in understanding the antiproliferative role of SSTR3 in breast tumor biology. PMID: 26112183
  3. In conclusions, in CNFAs, high expression of somatostatin receptors is much less common than that of D2R PMID: 25536318
  4. constitutive SSTR3 activity mediates transcriptional repression of GH. PMID: 24606125
  5. High SSTR3 expression is associated with gallbladder cancer. PMID: 23991955
  6. Determination of the expression of SSTR3 in an attempt to establish correlations and/or associations with clinical characteristics of patients with nonfunctioning pituitary adenomas. PMID: 22419713
  7. mRNA levels of SSTR2a, SSTR3 and SSTR5 in neuroendocrine lung cancer affected patients, were determined PMID: 21503779
  8. The cigarettes smoking and H. pylori infection are independent factors leading to decreasing of the SSTR3 mRNA level in gastric mucosa of patients with functional dyspepsia. PMID: 20570798
  9. There was a positive correlation between the percentage of tumor reduction by octreotide-lar and SSTR3 expression. PMID: 19330452
  10. expression of somatostatin (SS) and SS receptor (SSR) subtype 1 (sst1), sst2A, and sst3 in normal human thymic tissue PMID: 12376335
  11. localization and expression in human prostatic tissue and prostate cancer cell lines. PMID: 12474541
  12. Reduced SSTR3 expression is associated with gastric cancers PMID: 15197339
  13. Density of the SSTR3 receptor is decreased in gastric adenocarcinoma. H. pylori infection related reduction of the SSTR3 density in the antrum mucosa speaks for the need of eradication of these bacteria in the prevention of distal gastric cancer. PMID: 17679363
  14. Determine the influence of H. pylori infection and a family history of gastric cancer on the expression of SSTR3 in the gastric mucosa of non-cancer patients with dyspepsia. PMID: 17683502
  15. There was very little expression of SSTR3 in benign, premalignant, and cancerous laryngeal specimens; thus SSTR3 does not have an important role in laryngeal patholgy. PMID: 18066572
  16. Immunohistochemistry stufy of SSTR3 in prostate tissue from patients with bladder outlet obstruction showed that greatest proportion of basal cells showed a moderate intensity, strong immunoreactivity being observed only in 15.8% of cells. PMID: 18936524
  17. An interaction between the human somatostatin receptor 3 and the multiple PDZ protein MUPP1 was identified. PMID: 19071123

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Brain, pituitary and pancreas.
Database Links

HGNC: 11332

OMIM: 182453

KEGG: hsa:6753

STRING: 9606.ENSP00000330138

UniGene: Hs.225995

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X