Recombinant Human Sphingosine 1-phosphate receptor 1 (S1PR1)

Code CSB-CF020650HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
S1PR1; CHEDG1; EDG1; Sphingosine 1-phosphate receptor 1; S1P receptor 1; S1P1; Endothelial differentiation G-protein coupled receptor 1; Sphingosine 1-phosphate receptor Edg-1; S1P receptor Edg-1; CD antigen CD363
Species
Homo sapiens (Human)
Expression Region
1-382
Target Protein Sequence
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH PQKDEGDNPETIMSSGNVNSSS
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G-protein coupled receptor for the bioactive lysosphingolipid sphingosine 1-phosphate (S1P) that seems to be coupled to the G(i) subclass of heteromeric G proteins. Signaling leads to the activation of RAC1, SRC, PTK2/FAK1 and MAP kinases. Plays an important role in cell migration, probably via its role in the reorganization of the actin cytoskeleton and the formation of lamellipodia in response to stimuli that increase the activity of the sphingosine kinase SPHK1. Required for normal chemotaxis toward sphingosine 1-phosphate. Required for normal embryonic heart development and normal cardiac morphogenesis. Plays an important role in the regulation of sprouting angiogenesis and vascular maturation. Inhibits sprouting angiogenesis to prevent excessive sprouting during blood vessel development. Required for normal egress of mature T-cells from the thymus into the blood stream and into peripheral lymphoid organs. Plays a role in the migration of osteoclast precursor cells, the regulation of bone mineralization and bone homeostasis. Plays a role in responses to oxidized 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine by pulmonary endothelial cells and in the protection against ventilator-induced lung injury.
Gene References into Functions
  1. Overexpression of S1PR1 promoted subcutaneous xenograft growth and pulmonary metastases and enhanced expression of epithelial-to-mesenchymal transition markers. PMID: 30453284
  2. Knockdown of BATF3 in HL cell lines revealed that BATF3 contributed to the transcriptional programme of primary HRS cells, including the upregulation of S1PR1. PMID: 28878352
  3. Data suggest that sphingosine-1-phosphate receptor 1 (S1P1) exhibits a inhibitory effect on kidney ischemia/reperfusion injury-inducedepithelial to mesenchymal transition (EMT) in the kidney by affecting the PI3K/Akt pathway. PMID: 29901713
  4. Extracellular alpha-synuclein induces sphingosine S1P1R uncoupled from inhibitory G-protein leaving beta-arrestin signal intact. PMID: 28300069
  5. These results demonstrated that ApoM protein mass were clearly higher in the NSCLC tissues than in non-small cell lung cancer (NSCLC) tissues. Overexpression of ApoM could promote NSCLC cell proliferation and invasion in vitro and tumor growth in vivo, which might be via upregulating S1PR1 and activating the ERK1/2 and PI3K/AKT signaling pathways. PMID: 29750961
  6. We conclude that S1P attenuates the invasion of C643 cells by activating S1P2 and the Rho-ROCK pathway, by decreasing calpain activity, and by decreasing the expression, secretion and activity of MMP2 and, to a lesser extent, MMP9. Our results thus unveil a novel function for the S1P2 receptor in attenuating thyroid cancer cell invasion. PMID: 29734379
  7. Elevated S1PR1 expression and STAT3 activation are also observed in human NB cells with acquired resistance to etoposide. We show in vitro and in human NB xenograft models that treatment with FTY720, an FDA-approved drug and antagonist of S1PR1, dramatically sensitizes drug-resistant cells to etoposide. PMID: 28716816
  8. this review discusses sphingosine-1-phosphate receptor as a novel therapeutic target in ulcerative colitis PMID: 27494562
  9. Astrocytic S1PR controls astrocyte neurotoxicity and monocyte recruitment and activation. PMID: 28167760
  10. High S1PR1 expression is associated with anti-neutrophil cytoplasmic antibody-associated vasculitis. PMID: 28206609
  11. Low S1PR1 expression is associated with Coxsackievirus B3-induced myocarditis. PMID: 28986246
  12. These findings are consistent with a model in which signalling via S1P and S1PR1 are integral components in the response of lymphatic endothelial cells to the stimulus provided by fluid flow. PMID: 27974574
  13. S1PR1/3 silencing alters proliferation, adhesion, viability and lateral motility in estrogen receptor-negative MCF-7 and estrogen receptor-positive MDA-MB-231 breast cancer cells. PMID: 28982858
  14. Activated S1PR1 signaling regulates the production of cellular adhesion molecules by inhibiting NF- kappaB activation via a beta-arrestin2-dependent manner PMID: 28399143
  15. Model recombinant HDL (rHDL) particles formed in vitro with S1P incorporated into the particle initiated the internalization of S1PR1, whereas rHDL without supplemented S1P did not, suggesting that S1P transported in HDL can selectively activate S1PR1. PMID: 27881715
  16. Blocking of S1PR activity and inhibition of S1P synthesis led to decreased expression of fibrosis and tissue remodeling-related proteins in primary cultures of orbital fibroblasts derived from patients with GO. PMID: 28492873
  17. a lipid molecule repeatedly entered the receptor between the extracellular ends of TM1 and TM7, providing important insights into the pathway of ligand entry into the S1PR1 . PMID: 28370663
  18. Mature human thymocytes rely on S1P-R1 to migrate toward S1P. Taken in the context of murine work demonstrating that S1P is required for thymocyte egress to the periphery. PMID: 27056271
  19. ApoM-bound sphingosine-1-phosphate regulates adhesion molecule abundance, leukocyte-endothelial adhesion, and endothelial barrier function via sphingosine-1-phosphate receptor1. PMID: 27879252
  20. The S1P1,3 activation results in Akt phosphorylation and subsequent activation of eNOS via phosphorylation at serine(1177) and dephosphorylation at threonine(495). PMID: 27282481
  21. HDL-associated ApoM is anti-apoptotic by delivering sphingosine 1-phosphate to S1P1 and S1P3 receptors on vascular endothelium. PMID: 28179022
  22. The present high prevalence of S1PR1 overexpression warrants the consideration of testicular diffuse large B-cell lymphoma as a distinct disease subtype and suggests the potential of the S1P/S1PR1 axis as a therapeutic target. PMID: 27061580
  23. S1PR1 inhibits the apoptosis of human myeloid leukemia cells and promotes their proliferation. PMID: 27572094
  24. These results suggest that S1P signaling plays a role in cell proliferation and drug resistance in multiple myeloma, and targeting this pathway will provide a new therapeutic direction for multiple myelomamanagement. PMID: 27785703
  25. Sphingosine 1-phosphate-induced IL-8 gene expression is mainly regulated via S1PR(1), and its secretion is regulated through S1PR(2) receptor subtype. PMID: 26321412
  26. multiple lines of evidence demonstrate that S1PR1 signaling sets the sensitivity of pDC amplification of IFN responses, thereby blunting pathogenic immune responses PMID: 26787880
  27. The results indicate that sphingosine 1-phosphate is involved in the migration of precursor T-cell lymphoblastic leukemia-lymphoma blasts in vitro, which is dependent on S1P1 expression. PMID: 26824863
  28. Overexpression of miR148a or inhibition of S1PR1 suppressed SKOV3 cell migration and invasion, while restoration of S1PR1 expression reversed the suppressive effect of miR148a upregulation on SKOV3 cell migration and invasion. PMID: 26004261
  29. the ability of ApoM(+)HDL to act as a biased agonist on S1P1 inhibits vascular inflammation, which may partially explain the cardiovascular protective functions of HDL. PMID: 26268607
  30. S1P receptor modulation reduces leukocyte migration across the endothelial barrier PMID: 26197437
  31. SGPL1 ratio correlated with increased cellular sphingosine-1-phosphate (S1P), and S1P correlated with drug resistance (IC50). PMID: 26493335
  32. The role of sphingosine-1-phosphate in the production of immature double-negative thymocytes in experimental and chronic Chagas disease is reported. PMID: 25330249
  33. Within lymphoid follicles, the S1P1 distribution pattern is complementary to that of CCR7/CXCR4, with strong immunoreactivity tightly restricted to mantle zone B cells. This may play a role in B-cell migration toward the S1p-enriched follicle center. PMID: 26282174
  34. Ponesimod, a selective S1P1 receptor modulator, causes small, dose-dependent QT prolongation. PMID: 25287214
  35. rapid reduction of endothelial cell surface expression of S1PR1 subsequent to Y143 phosphorylation is a crucial mechanism of modulating S1PR1 signaling, and hence the endothelial barrier repair function of S1P. PMID: 25588843
  36. Sphingosine-1-phosphate promotes extravillous trophoblast cell invasion by activating MEK/ERK/MMP-2 signaling pathways via S1P/S1PR1 axis activation. PMID: 25188412
  37. both S1PR1 and S1PR2 play a pivotal role in hyperglycemia-induced EC dysfunction and endothelial injury by reducing and enhancing the production of oxidative stress. PMID: 25673082
  38. S1PR1 expression was associated with unfavourable clinicopathological features and the expression of several anti-apoptosis/proliferation-related markers in urothelial carcinoma. PMID: 26238015
  39. Data suggest an SNP in S1PR1 (rs41287280) is associated with protection against coronary artery disease; some SNPs in S1PR1 have the effect that endocytosis is resistant to S1PR1 antagonists (fingolimod) or S1PR1 agonists (sphingosine 1-phosphate). PMID: 25293589
  40. Activation of the S1PR1-PLC-IP3 R-Ca(2+) -Rac1 pathway governs the low-dose S1P-enhanced endothelial barrier integrity. PMID: 25557733
  41. S1P interacts with its receptors on neutrophils, resulting in NADPH oxidase activation by the PI3K-Akt cell signaling pathway and induction of the neutrophil respiratory burst. PMID: 25872153
  42. S1P1 is widely expressed across tissues and, when activated, has broad functions in the immune, vascular and nervous systems. [Review] PMID: 25498971
  43. Our data demonstrate that neuronal cell death evoked by ceramide is regulated by PARP/PAR/AIF and by S1P receptor signalling. PMID: 24420784
  44. Expression of functional S1PR1 is reduced by B cell receptor signaling and increased by inhibition of PIK3CD but not SYK or BTK in chronic lymphocytic leukemia cells. PMID: 25632006
  45. The data demonstrates that S1P1 expression is differentially modulated in grey matter and white matter lesions in multiple sclerosis. PMID: 23551178
  46. S1PR1 was a target of miR-125b-1-3p in the placenta. Overexpression of S1PR1 could reverse the inhibitory effect of miR-125b-1-3p on the invasion of trophoblast cells. Abnormal expression of miR-125b-1-3p might contribute to the etiology of preeclampsia. PMID: 25251470
  47. Study demonstrates a stark contrast between the consequences of S1PR1 signaling in Treg cells in the periphery versus tumors. PMID: 24630990
  48. Aberrant S1PR1 expression in colorectal cancer was associated with metachronous liver metastasis and worse survival outcome PMID: 24972972
  49. Data show that sphingosine kinase SphK1 and sphingosine-1-phosphate (S1P) receptors S1P1, S1P2, S1P3, and S1P5 were expressed from primary, up to recurrent and secondary glioblastomas, with sphingosine kinase SphK2 levels were highest in primary tumors. PMID: 24903384
  50. study demonstrates loss of S1P and sphingosine kinase activity early in AD pathogenesis, and prior to AD diagnosis. Our findings establish a rationale for further exploring S1P receptor pharmacology in the context of AD therapy. PMID: 24456642

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome. Membrane raft. Note=Recruited to caveolin-enriched plasma membrane microdomains in response to oxidized 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine. Ligand binding leads to receptor internalization.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Endothelial cells, and to a lesser extent, in vascular smooth muscle cells, fibroblasts, melanocytes, and cells of epithelioid origin.
Database Links

HGNC: 3165

OMIM: 601974

KEGG: hsa:1901

STRING: 9606.ENSP00000305416

UniGene: Hs.154210

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1