Recombinant Human Transient receptor potential cation channel subfamily V member 2 (TRPV2)

Code CSB-CF897571HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
TRPV2
Uniprot No.
Alternative Names
TRPV2; VRL; Transient receptor potential cation channel subfamily V member 2; TrpV2; Osm-9-like TRP channel 2; OTRPC2; Vanilloid receptor-like protein 1; VRL-1
Species
Homo sapiens (Human)
Expression Region
1-764
Target Protein Sequence
MTSPSSSPVFRLETLDGGQEDGSEADRGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNY RKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDSEYTEGSTGKTCL MKAVLNLKDGVNACILPLLQIDRDSGNPQPLVNAQCTDDYYRGHSALHIAIEKRSLQCVK LLVENGANVHARACGRFFQKGQGTCFYFGELPLSLAACTKQWDVVSYLLENPHQPASLQA TDSQGNTVLHALVMISDNSAENIALVTSMYDGLLQAGARLCPTVQLEDIRNLQDLTPLKL AAKEGKIEIFRHILQREFSGLSHLSRKFTEWCYGPVRVSLYDLASVDSCEENSVLEIIAF HCKSPHRHRMVVLEPLNKLLQAKWDLLIPKFFLNFLCNLIYMFIFTAVAYHQPTLKKQAA PHLKAEVGNSMLLTGHILILLGGIYLLVGQLWYFWRRHVFIWISFIDSYFEILFLFQALL TVVSQVLCFLAIEWYLPLLVSALVLGWLNLLYYTRGFQHTGIYSVMIQKVILRDLLRFLL IYLVFLFGFAVALVSLSQEAWRPEAPTGPNATESVQPMEGQEDEGNGAQYRGILEASLEL FKFTIGMGELAFQEQLHFRGMVLLLLLAYVLLTYILLLNMLIALMSETVNSVATDSWSIW KLQKAISVLEMENGYWWCRKKQRAGVMLTVGTKPDGSPDERWCFRVEEVNWASWEQTLPT LCEDPSGAGVPRTLENPVLASPPKEDEDGASEENYVPVQLLQSN
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Calcium-permeable, non-selective cation channel with an outward rectification. Seems to be regulated, at least in part, by IGF-I, PDGF and neuropeptide head activator. May transduce physical stimuli in mast cells. Activated by temperatures higher than 52 degrees Celsius; is not activated by vanilloids and acidic pH.
Gene References into Functions
  1. TRPV2 mediates IL-8 secretion and calcium signaling in testicular peritubular cells. PMID: 30235802
  2. TRPV2 expression was inversely correlated with CRP and TpI and directly correlated with serum IGF-1. We assume that peripheral TRPV2 downregulation occurs concomitantly with the accumulation of TRPV2-white blood cells in the peri-infarct zone. TRPV2 may thus represent a novel target for treatment in the acute phase after MI. PMID: 29393104
  3. the expression of transient receptor potential vanilloid-1 (TRPV1), transient receptor potential vanilloid-2 (TRPV2) and transient receptor potential vanilloid-3 (TRPV3) channels in native human odontoblasts, was examined. PMID: 28905239
  4. High TRPV2 expression is associated with breast cancer. PMID: 26993604
  5. Binding of capsaicin to TRPV2_Quad antagonizes resiniferatoxin-induced activation likely through competition for the same binding sites. PMID: 27298359
  6. both TRPV2 and TRPV4 are involved in migration of human cardiac c-kit(+) progenitor cells. PMID: 26865051
  7. The results of the study show that polymorphism of TRPV2 influenced the susceptibility to FM. PMID: 27079220
  8. CGRP- and TRPV2-containing trigeminal neurons probably innervate the paranasal sinus mucosae, and project into spinal and principal trigeminal sensory nuclei. PMID: 27553072
  9. transient receptor potential vanilloid 2 is an intracellular Ca(2+)-permeable transient receptor potential vanilloid channel upregulated by nerve growth factor via the mitogen-activated protein kinase signaling pathway to augment neurite outgrowth. PMID: 26416880
  10. Using multiple sequence alignments as source for evolutionary, bioinformatics and statistical analysis, we have analyzed the evolutionary profiles for TRPV1, TRPV2, TRPV3 and TRPV4 PMID: 25333484
  11. There appears to be TRPV1- or TRPV2-IR sympathetic pathway in the human stellate ganglion and spinal cord. PMID: 25641129
  12. This study evaluated the role of Trpv2 in arthritis and the pharmacological effects of Trpv2 agonists. PMID: 25869297
  13. High expression of TRPV2 mRNA was closely associated with advanced pathological stage and worse survival of patients with esophageal squamous cell carcinoma. PMID: 24878697
  14. Aim of this review is to study the role of the TRPV2 channel, a member of the TRPV subfamily of TRP channels, in tumor progression. [review] PMID: 25001513
  15. TRPV1-, TRPV2-, P2X3-, and parvalbumin-immunoreactivity neurons in the human nodose ganglion innervate the pharynx and epiglottis through the pharyngeal branch and superior laryngeal nerve PMID: 24764033
  16. Data indicate that transient receptor potential vanilloid 2 (TRPV2) siRNA virtually abolished stretch-activated current. PMID: 25268680
  17. An upregulation in the expression of vanilloid transient potential channels 2 enhances hypotonicity-induced cytosolic Ca(2) rise in human induced pluripotent stem cell model of Hutchinson-Gillford Progeria. PMID: 24475260
  18. Sarcolemmal TRPV2 accumulation appears to have considerable pathological impact on Dilated cardiomyopathy (DCM) progression. PMID: 23786999
  19. The addition of TRPV2 inhibitor Tranilast in the incubation medium prevent the calcium influx triggered by lysoPC and reduced lysoPC-induced cytotoxicity,whereas TRPV4 inhibitor RN 1734 was without effect PMID: 23964684
  20. TRPV2 mediates adrenomedullin stimulation of prostate and urothelial cancer cell adhesion, migration and invasion. PMID: 23741410
  21. TRPV1 and TRPV2 are potential targets for potential therapeutic interventions in cardiovascular disease. PMID: 23453732
  22. Duchenne muscular dystrophy primary human myotubes exhibit abnormal elevation of TRPV2-dependant cation entry. PMID: 23426965
  23. TRPV2 plays a key role in mast-cell degranulation in response to mechanical, heat and red laser-light stimulation. PMID: 21574765
  24. The increased expression of TRPV2 gene in peripheral lymphocytes is closely correlated with childhood asthma in the north of China. PMID: 23294145
  25. TRPV2-coupled signaling as a key player in mediating the cellular actions of heat shock on DCs PMID: 23542034
  26. Cultivated HCjE cells and human conjunctiva express TRPV2, mRNA. PMID: 22327830
  27. Human corneal epithelial cells possess thermosensitive TRPV2 activity. PMID: 21506114
  28. A calmodulin binding site was located in the C-termini of TRPV2 (654-683) and TRPV5 (587-616). PMID: 20686800
  29. Decrease in membrane phosphatidylinositol 4,5-bisphosphate (PIP2) levels on channel activation underlies a major component of divalent calcium ion-dependent desensitization of TRPV2 and may play a similar role in other TRP channels. PMID: 20926660
  30. TRPV2 negatively controls glioma cell survival and proliferation, as well as resistance to Fas-induced apoptotic cell death in an ERK-dependent manner. PMID: 20093382
  31. Findings establish a role for TRPV2 in PCa progression to the aggressive castration-resistant stage, prompting evaluation of TRPV2 as a potential prognostic marker and therapeutic target in the setting of advanced PCa. PMID: 20103638
  32. TRPV2 plays a role in human hepatocarcinogenesis and might be a prognostic marker of patients with hepatocellular carcinoma (HCC). PMID: 20113837
  33. TRPV2 and PKA have roles as a signaling module for transduction of physical stimuli in mast cells PMID: 15249591
  34. It is concluded that PI3-kinase induces or modulates the activity of recombinant TRPV2 channels; in contrast to the previously proposed mechanism, activation of TRPV2 channels by PI3-kinase is not due to channel translocation to the plasma membrane. PMID: 16533525
  35. Both TRPV1 and TRPV2 are found in human peripheral blood lymphocytes. PMID: 16777226
  36. The TRPV2 ARD provides the first structural insight into a domain that coordinates nociceptive sensory transduction and is likely to be a prototype for other TRPV channel ARDs PMID: 16882997
  37. A progressive loss of s-TRPV2 accompanied by an increase of hTRPV2 expression was found in high-grade and -stage UC. PMID: 17977643
  38. Messenger RNA transcripts of TRPVs 1 through 4 are detected for the first time in human pulmonary artery smooth muscle cells. PMID: 18787888
  39. relative gene expression ofTRPV1-4 in leukocytes is: TRPV3 < TRPV4, TRPV1 and TRPV2; leukocytes in hyposensitive subjects showed up-regulation of TRPV1, which was almost doubly expressed PMID: 18983665
  40. The reduction of TRPV2 and TRPM8 immunoreactive nerve fibers in skin from individuals with Norrbottnian congenital insensitivity to pain further suggests that these ion channels are expressed primarily on nociceptive primary sensory neurons. PMID: 19482060
  41. TRPV1-immunoreactivity was significantly higher and TRPV2-immunoreactivity was significantly lower in peripheral blood mononuclear cells from end-stage kidney disease patients compared to controls. PMID: 19619644

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasm. Melanosome.
Protein Families
Transient receptor (TC 1.A.4) family, TrpV subfamily, TRPV2 sub-subfamily
Database Links

HGNC: 18082

OMIM: 606676

KEGG: hsa:51393

STRING: 9606.ENSP00000342222

UniGene: Hs.279746

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1