Recombinant Human Tripartite motif-containing protein 59 (TRIM59)

Code CSB-CF808999HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
TRIM59
Uniprot No.
Alternative Names
TRIM59; RNF104; TRIM57; TSBF1; Tripartite motif-containing protein 59; RING finger protein 104; Tumor suppressor TSBF-1
Species
Homo sapiens (Human)
Expression Region
1-403
Target Protein Sequence
MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENILQASGNFYIWRPLRIPLKCPNCR SITEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEHYRQPLNVYCLLDKKLVCGHC LTIGQHHGHPIDDLQSAYLKEKDTPQKLLEQLTDTHWTDLTHLIEKLKEQKSHSEKMIQG DKEAVLQYFKELNDTLEQKKKSFLTALCDVGNLINQEYTPQIERMKEIREQQLELMALTI SLQEESPLKFLEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNV LIPKMKISPKRMSCSWPGKDEKEVEFLKILNIVVVTLISVILMSILFFNQHIITFLSEIT LIWFSEASLSVYQSLSNSLHKVKNILCHIFYLLKEFVWKIVSH
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May serve as a multifunctional regulator for innate immune signaling pathways.
Gene References into Functions
  1. TRIM59 expression is upregulated in hepatocellular carcinoma (HCC) cells; TRIM59 promotes cell proliferation, migration and invasion in HCC cells PMID: 29442042
  2. The level of TRIM59 is correlated with malignant features of colorectal carcinoma (CRC)and may serve as potential therapeutic and preventive strategies for CRC PMID: 28849218
  3. Knockdown of TRIM59 may be a promising strategy concerning the early detection and treatment of Renal cell carcinoma. PMID: 28719348
  4. TRIM59 overexpression is associated with colorectal cancer metastasis. PMID: 28534983
  5. our results suggest that rs1141023 polymorphism contributes to increased predisposition to gastric cancer PMID: 28009992
  6. The expression of TRIM59 was significantly elevated in cervical cancers. PMID: 27662486
  7. These data suggest the oncogenic abilities of TRIM59 in osteosarcoma, which promote osteosarcoma cell proliferation, migration and invasion PMID: 27121462
  8. we knocked down TRIM59 and found that p53 protein expression levels did not upregulate, so we proposed that TRIM59 may promote NSCLC cell growth through other pathways but not the p53 signaling pathway PMID: 26599082
  9. TRIM59 interacts with P53, promoting its ubiquitination and degradation, and TRIM59 might promote gastric carcinogenesis via this mechanism. PMID: 25046164
  10. These findings indicate that TRIM59 may serve as a multifunctional regulator for innate immune signaling pathways. PMID: 22588174
  11. PMID:12095697 pertains to mouse Mrf1 gene which appears to be the homolog of human TSBF1. PMID: 12095697

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Protein Families
TRIM/RBCC family
Database Links

HGNC: 30834

OMIM: 616148

KEGG: hsa:286827

STRING: 9606.ENSP00000311219

UniGene: Hs.212957

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1