Recombinant Mouse Adiponectin receptor protein 2 (Adipor2)

Code CSB-CF805321MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Adipor2; D6Ucla1e; Parq2; Adiponectin receptor protein 2; Progestin and adipoQ receptor family member 2; Progestin and adipoQ receptor family member II
Species
Mus musculus (Mouse)
Expression Region
1-386
Target Protein Sequence
MNEPAKHRLGCTRTPEPDIRLRKGHQLDDTRGSNNDNYQGDLEPSLETPVCSSYYENSPE EPECHDDNSQEDEGFMGMSPLLQAHHAMERMEEFVCKVWEGRWRVIPHDVLPDWLKDNDF LLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQE KVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFY CNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFVGLGLSGIIPTLHYVISE GFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAF VHFHGVSNLQEFRFMIGGGCTEEDAL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism. Required for normal body fat and glucose homeostasis. ADIPOQ-binding activates a signaling cascade that leads to increased PPARA activity, and ultimately to increased fatty acid oxidation and glucose uptake. Has intermediate affinity for globular and full-length adiponectin. Required for normal revascularization after chronic ischemia caused by severing of blood vessels.
Gene References into Functions
  1. these results demonstrate that AdipoR1 and AdipoR2 exhibit overlapping and distinct effects in skeletal muscle consistent with enhanced adiponectin sensitivity but these appear insufficient to ameliorate established obesity-induced adiponectin resistance. PMID: 28145500
  2. macrophage polarization is a key determinant regulating AdipoR expression and differential APN-mediated macrophage inflammatory responses PMID: 25392268
  3. AdipoR1, but not AdipoR2 deficiency, leads to diet-induced metabolic dysfunction, revealing that these receptors have highly divergent roles in vascular and metabolic homeostasis PMID: 24742672
  4. Data suggest GnRH (gonadotropin-releasing hormone) neurons in forebrain express AdipoR2 (not AdipoR1); adiponectin/AdipoR2 signal transduction via protein kinase C zeta down-regulates neurotransmission in subpopulation of GnRH neurons. PMID: 24564393
  5. These results prove that elevation of adiponectin and/or adipoR2 expression via gene transfer is an effective approach in managing obesity epidemics. PMID: 23425917
  6. APN, AdipoR1, and AdipoR2 exist in human and mouse retinas and retinal APN and AdipoR1 protein levels are elevated in type 1 diabetes mellitus mice. PMID: 23922494
  7. Our findings demonstrate that exercise training performed concomitantly to a high-fat diet reduces the degree of insulin resistance and improves adipoR1-2/APPL1 protein levels in the hepatic, adipose, and skeletal muscle tissue. PMID: 23046739
  8. Human biosynthetic insulin had little or no effect in the regulation of AdipoR1 expression in 3T3-L1 cells, but significantly up-regulated AdipoR2 mRNA level in a biphasic manner. PMID: 23043361
  9. Gene expression of adiponectin and AdipoR1/AdipoR2 receptors gradually increases during the wound healing process. PMID: 22904306
  10. The messenger RNA expression levels of hepatic adiponectin receptor (AdipoR)-1 and AdipoR2 and skeletal muscular AdipoR1 were up-regulated by tiliroside treatment. PMID: 21889885
  11. This study demonistrated that AdipoR2 is expressed on warm sensitive neurons of the hypothalamic preoptic area and contribute to central hyperthermic effects of adiponectin. PMID: 22000082
  12. Adipoq signaling has a role in preimplantation embryo development and uterine receptivity. PMID: 21106494
  13. investigation of expression and localization of Adipor2 & Adipor1 during embryo development PMID: 20663797
  14. the adiponectin receptor 2 (AdipoR2) was differentially regulated by alcohol in the anterior cingulate cortex in a K-ras-dependent manner PMID: 20380822
  15. Data suggest that low adiponectin receptors 1 and 2 in visceral adipocytes and adipose tissue and further suppression in adipose tissue of insulin-resistant animals indicate disturbed adiponectin bioactivity. PMID: 20470935
  16. Liver steatosis is associated with downregulation of AdipoR2 and a reduction of AdipoR2 in the liver and with a reduction of serum adiponectin in the obese C57BL mouse. PMID: 19763702
  17. the expression of AdipoR2 and (mainly) AdipoR1 in the mouse adrenal cortex and the adrenocortical cell line Y-1 was detected. PMID: 19878661
  18. cloning of cDNAs encoding adiponectin receptors 1 and 2 (AdipoR1 and AdipoR2) by expression cloning [AdipoR1 & AdipoR2] PMID: 12802337
  19. Growth hormone is a positive regulator of AdipoR2. PMID: 14759511
  20. adiponectin receptor expression is regulated by insulin and Foxo1 PMID: 15123605
  21. RT-PCR revealed the expression of the adiponectin receptor AdipoR1 mRNA in mouse islets, however, with no difference in the degree of expression level between the two dietary fat feeding groups. PMID: 15358228
  22. a link between adiponectin and bone homeostasis by demonstrating transcription, translation, and secretion of adiponectin, as well as expression of its receptors, AdipoR1 and AdipoR2, in bone-forming cells PMID: 15454091
  23. Our results indicate that regulation of AdipoR1, but not that of AdipoR2, may be involved in glucose and lipid metabolism in diabetic states. PMID: 15613685
  24. In conclusion, our results suggest a fat depot specific regulation of AdipoR1 and AdipoR2 gene expression in brown and white fat by fasting. PMID: 15752770
  25. AdipoR1 and AdipoR2 have differential but overlapping expression profiles during mouse development PMID: 15939384
  26. Wy-14,643 treatment upregulated expression of the adiponectin receptor (AdipoR)-1 and AdipoR2. PMID: 16306350
  27. Reduced circulating adiponectin occurs in rat fatty liver disease, but it is elevated in a mouse cirrhosis with similar findings in humans. Diminished hepatic expression of adiponectin receptors (AdipoR2 and AdipoR1) was only found in liver cirrhosis. PMID: 17006986
  28. A defect in the AdipoR2 gene may represent a mechanism underlying the etiology of certain subgroups of type 2 diabetic patients who eventually develop overt diabetes, whereas other obese patients do not. PMID: 17068142
  29. Advanced age and high-fat feeding, both of which are factors that predispose humans to obesity and insulin resistance, are associated with decreasing adiponectin and increasing AdipoR1 and/or AdipoR2 levels. PMID: 17164441
  30. Adipo1 and 2 serve as the predominant receptors for adiponectin in vivo and play important roles in the regulation of glucose and lipid metabolism, inflammation and oxidative stress in vivo. PMID: 17268472
  31. The physiological importance OF Adipor1 and Adipor2 in glucose and lipid metabolism and the risk for obesity, type 2 diabetes, and cardiovascular disease is reported. PMID: 17327425
  32. acute exercise affects the expression level of adiponectin receptors; an increase of Foxo1 expression might be relative to regulate adiponectin receptors. PMID: 17647137
  33. Physical training for 4 weeks resulted in increased AdipoR1 and AdipoR2 mRNA expression in subcutaneous fat and may insulin resistance. PMID: 17878241
  34. Adiponectin receptor 1 and 2 (AdipoR1 and R2) mRNA levels in liver and skeletal muscle were normal but hepatic insulin receptor mRNA was increased in growth hormone/lactogen-mutant mice PMID: 17975745
  35. AdipoR2 mRNA levels are decreased in diet induced diabetic mice. PMID: 18222103
  36. Adiponectin resistance and sensitivity mediated by AdipoR2 in hepatocytes regulated steatohepatitis progression by changing PPAR-alpha activity and reactive oxygen species accumulation. Promising target in treating fatty liver. PMID: 18666257
  37. Adiponectin (APN) induces IL-6 production mediated by APN receptor 1, not APN receptor 2, in adult mouse cardiac fibroblasts, which leads to the stimulation of the gp130/Janus kinase signalling pathway, and as a result causes STAT3 activation. PMID: 18795895
  38. Adipor1 and Adipor2 were present in proopiomelanocortin and neuropeptide Y neurons in the arcuate nucleus. PMID: 18971219
  39. Gene expression of AdipoR2 is significantly lower in the liver ob obese mice. PMID: 19062045
  40. results suggest that AdiR2 expression is regulated by palmitate via PPAR-alpha. PMID: 19336949
  41. Results characterise the expression and interaction of adiponectin receptors 1 and 2 and adiponectin, respectively, in regulating the activity of growth hormone-secreting cells. PMID: 19500219

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
ADIPOR family
Tissue Specificity
Detected in liver and quadriceps muscle (at protein level). Highly expressed in liver. Highly expressed in white adipose tissue, and at intermediate levels in brown adipose tissue. Expressed at intermediate level in heart, kidney, lung and skeletal muscle
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×