Recombinant Mouse Claudin-4 (Cldn4)

Code CSB-CF005506MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Cldn4; Cper; Cpetr1; Claudin-4; Clostridium perfringens enterotoxin receptor; CPE-R; CPE-receptor
Species
Mus musculus (Mouse)
Expression Region
1-210
Target Protein Sequence
MASMGLQVLGISLAVLGWLGIILSCALPMWRVTAFIGSNIVTAQTSWEGLWMNCVVQSTG QMQCKMYDSMLALPQDLQAARALMVISIIVGALGMLLSVVGGKCTNCMEDETVKAKIMIT AGAVFIVASMLIMVPVSWTAHNVIRDFYNPMVASGQKREMGASLYVGWAASGLLLLGGGL LCCSCPPRSNDKPYSAKYSAARSVPASNYV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Channel-forming tight junction protein that mediates paracellular chloride transport in the kidney. Plays a critical role in the paracellular reabsorption of filtered chloride in the kidney collecting ducts. Claudins play a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Gene References into Functions
  1. a Grhl2/Ovol2 network controls Cldn4 and Rab25 expression that facilitates lumen expansion and barrier formation in subtypes of renal epithelia PMID: 25788534
  2. Data show that claudin-4 and claudin-7 were observed in hepatocytes of severely damaged mouse and human livers. PMID: 24737165
  3. The claudin-4-mediated chloride conductance can be regulated endogenously by a protease-channel-activating protease 1 (cap1). PMID: 25157135
  4. Cld4 is selectively expressed on the surface of enteroendocrine cells in the mouse small intestine. PMID: 24603700
  5. Claudin 4 has little effect on normal lung physiology but may function to protect against acute lung injury in mice. PMID: 25106430
  6. The results suggest that progressive hydronephrosis in Cldn4(-/-) mice arises from urinary tract obstruction due to urothelial hyperplasia, and that Cld4 plays an important role in maintaining the homeostatic integrity of normal urothelium. PMID: 23284964
  7. Claudin-3 in the apical-most regions maintains the impermeable tight junctions during lactation, and claudin-4 contributes PMID: 21912970
  8. Claudin-4 overexpression is associated with epigenetic derepression in gastric carcinoma. PMID: 21844869
  9. results suggest that Cld4 is induced by E-protein activity in the later stages of DP cells to increase the efficiency of positive selection, uncovering a hitherto unrecognized function of a Cld family protein PMID: 21325057
  10. data show that claudin-4 interacts with claudin-8 and that their association is required for the anion-selective paracellular pathway in the collecting duct PMID: 20921420
  11. quaternary structure analysis of recombinant protein PMID: 12538885
  12. Experimental obstructive jaundice increases claudin-4 expression in intestinal epithelium, which may be a key factor contributing to the disruption of the mucosal barrier. PMID: 16733860
  13. In the absence of follicle-stimulating hormone receptor signaling, claudin-4 is selectively upregulated in ovarian surface epithelium and tumors in comparison to wild type. PMID: 17217615
  14. Claudin 4 has been found in mouse taste epithelium, with high abundance around the taste pore. A highly specific permeability pattern for paracellular diffusion is apparent, which indicates a peripheral mechanism for taste coding. PMID: 17447253
  15. mouse trophectoderm expressed claudin 4 essential for blastocyst formation in preimplantation mouse embryos PMID: 17980358
  16. Structural constraints for the binding of short peptides to claudin-4 revealed by surface plasmon resonance. PMID: 18782762
  17. We found that claudin-4 contains a sequence which is phosphorylated by atypical PKC (aPKC). These findings suggest that aPKC regulates tight junction formation through the phosphorylation of claudin-4. PMID: 18786529
  18. MUPP1 contributes to the maintenance of a tight epithelium in the medulla of the kidney under hypertonic stress by correctly localizing Cldn4 to the tight junctions PMID: 18840681
  19. changes in alveolar epithelial claudin expression influence paracellular transport, alveolar fluid clearance rates, and susceptibility to pulmonary edema PMID: 19447895

Show More

Hide All

Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Protein Families
Claudin family
Tissue Specificity
Expressed primarily in lung and kidney. Present in both cortical and medullar collecting ducts (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1