Recombinant Mouse Claudin-5 (Cldn5)

Code CSB-CF005507MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Cldn5
Uniprot No.
Alternative Names
Cldn5; Bec1; Claudin-5; Brain endothelial cell clone 1 protein; Lung-specific membrane protein
Species
Mus musculus (Mouse)
Expression Region
1-218
Target Protein Sequence
MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTG HMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLTGAQCTTCVAPGPVKARVALT GGALYAVCGLLALVPLCWFANIVVREFYDPTVPVSQKYELGAALYIGWAASALLMCGGGL VCCGAWVCTGRPEFSFPVKYSAPRRPTANGDYDKKNYV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Gene References into Functions
  1. This study demonstrated that the claudin-5(+) leukocytes in the central nervous system during neuroinflammation: a novel role for endothelial-derived extracellular vesicles. PMID: 27852330
  2. Claudin 5 in a murine model of allergic asthma: Its implication and response to steroid treatment PMID: 26409663
  3. while MMP-9 is not essential for hypoxic-induced cerebral angiogenesis, it plays an important role in post-hypoxic vascular pruning by degrading laminin and claudin-5 PMID: 25812799
  4. Studied if circulating TGFbeta1 drives changes in tight junction protein expression and MMP9 activity following acute liver failure; Mouse brain endothelial cells were treated with recombinant rTGFbeta1 and MMP9 and claudin-5 expression was assessed. PMID: 26006017
  5. In transgenic mice carrying mutated SOD1 genes, a disrupted blood-spinal cord barrier as well as decreased levels of tight junction proteins ZO-1, occludin, and claudin-5 were detected. PMID: 25853911
  6. The aim of the present study was to further characterize the estrogen-responsive elements of claudin-5 promoter. PMID: 24846172
  7. Two independent pathways triggered by PI3K mediate early and late loss of paracellular claudin-5 expression. PMID: 25281324
  8. Comparative modelling of intramolecular interfaces in the transmembrane region of claudins led to a complete Cldn5 model. PMID: 25174580
  9. silencing of claudin-5 did significantly attenuate simvastatin-mediated endothelial cell barrier protection in response to thrombin PMID: 24028293
  10. Claudin 5 showed identical mRNA expression levels in the brains of adult and aged mice. PMID: 22120415
  11. TNFalpha acts through NFkappaB signaling and requires a conserved promoter region for the down-regulation of Cldn5 expression. PMID: 22138107
  12. In female rats, increasing age and 17beta-estradiol treatment alters the expression of ERalpha and distinct blood-brain barrier tight-junction protein isoforms (occludin and claudin-5) without altering functional paracellular permeability. PMID: 21192956
  13. These findings suggest that claudin-5 is a main claudin expressed in podocytes and that the formation of tight junctions in the nephrosis may be due to local recruitment of claudin-5 rather than due to total upregulation of the claudin protein levels. PMID: 21271259
  14. This study sought to determine the cell signaling mechanism controlling endothelial CLDN5 expression during acute lung injury. PMID: 20525806
  15. envision that substances interfering with Cldn5-mediated paracellular barrier tightening could assist an improved drug delivery into the brain because Cldn5 is essential for blood-brain barrier integrity. PMID: 20080584
  16. Describe claudin-5 as a novel estrogen target in vascular endothelium and show in vivo (brain endothelium) and in vitro (brain and heart endothelium) effects of estrogen on claudin-5 levels. PMID: 19910637
  17. tight junctions in dermal vascular endothelial cells are composed of claudin-5. PMID: 12823443
  18. claudin-5 is specifically altered in utrophin/dystrophin-deficient (double knockout, dko hearts, suggesting that alterations of the lateral membranes of cardiomyocytes PMID: 15698839
  19. Measured changes in claudin5 after cardiac arrest in mouse lung in relation to warm ischemia time and lung injury. PMID: 18281348
  20. Amyotrophic lateral sclerosis-linked superoxide dismutase 1 (SOD1) mutants with different biochemical characteristics disrupted the blood-spinal cord barrier in mice by reducing the levels of the tight junction protein claudin-5. PMID: 18344992
  21. Hydrodynamic tail vein injection of Cldn5 siRNA attenuates Cldn5 expression. PMID: 18509865
  22. Tissue-specific regulation of the claudin-5 gene via glucocorticoids and a high vulnerability of claudin-5 to TNF alpha. PMID: 18996436
  23. the pro-inflammatory chemokine CCL2 mediates brain endothelial barrier disruption during CNS inflammation PMID: 19423710
  24. CLDN5 is expressed in the seminiferous epithelium, appears to be regulated by multiple influences, and contributes to blood-testis barrier function. PMID: 19571261
  25. Disruptions of occludin and claudin-5 in brain endothelial cells in vitro and in brains of mice with acute liver failure. PMID: 19821483

Show More

Hide All

Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Protein Families
Claudin family
Tissue Specificity
Widely expressed with highest levels in the lung.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1