Recombinant Mouse D (1B) dopamine receptor (Drd5)

Code CSB-CF804368MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Drd5; D(1B dopamine receptor; D(5 dopamine receptor; Dopamine D5 receptor
Species
Mus musculus (Mouse)
Expression Region
1-478
Target Protein Sequence
MLPPGRNGTAHRARLGLQRQLAQVDAPGGSAAPLGPAQVVTAGLLTLLIVWTLLGNVLVC AAIVRSRHLRAKMTNIFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDIWVAFDIM CSTASILNLCIISVDRYWAISRPFRYERKMTQRVALVMVALAWTLSILISFIPVQLNWHR DKAGSQGREGLLSNETPWEEGWELDGRTENCDSSLNRTYAISSSLISFYIPVAIMIVTYT RIYRIAQVQIRRISSLERAAEHAQSCRSRGACEPDPSLRASIKKETKVFKTLSVIMGVFV CCWLPFFILNCMVPFCSSGDAQGPRTGFPCVSETTFDIFVWFGWANSSLNPIIYAFNADF RKVFAQLLGCSHLCFRTPVQTVNISNELISYNQDTVFHREIAAAYVHMIPNAVSSGDREV GEEEEAEEEGPFDHMSQISPTTPDGDLAAESVWELDCEEEVSLGKISPLTPNCFHKTA
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.
Gene References into Functions
  1. n T2 mice, the mRNA expression of Retn showed a moderate up-regulation (fold change=8.32; p=0.0019) in the adipose tissues. Iapp expression was also significantly up-regulated (fold change=9.78; p=0.012). Moreover, a 6.36-fold up-regulation for Drd5 was observed in the adipose tissues of T2 mice PMID: 29936463
  2. Findings demonstrate the relevant contribution of dopamine receptor D5 (D5R) in memory and suggest a functional interaction of D5R with hippocampal glutamatergic pathways. PMID: 26714288
  3. We suggest that the ability of the dopamine D5 receptor to negatively regulate the renal NADPH oxidase activity and AT1R function may have important implications in the pathogenesis of salt-sensitive blood pressure. PMID: 25716648
  4. This study demonstrated that D5R stimulation contributes to an efficient CD4(+)T-cell-induced early ERK1/2 phosphorylation, and differentiation. PMID: 26025054
  5. The dopamine D5 receptors are particularly important in regulating plasticity of the medial perforant path onto the dentate granule cells. PMID: 25429131
  6. This study demonistrated that the dopamine D5 receptor as a regulator of BDNF and Akt signalling in rodent prefrontal cortex. PMID: 22827965
  7. SNX1 has a crucial role in D(5)R trafficking and SNX1 depletion results in D(5)R dysfunction and thus may represent a novel mechanism for the pathogenesis of essential hypertension PMID: 23152498
  8. By contributing to CD4(+) T cell activation and differentiation to Th17 phenotype, D5R expressed on DCs is able to modulate the development of an autoimmune response in vivo. PMID: 22379034
  9. We propose that ciliary DR5 has functional chemo- and mechano-sensory roles in endothelial cells. PMID: 21709211
  10. There is a role of renal D(5) receptors in blood pressure homeostasis and the pathogenesis of hypertension in mice. PMID: 21051739
  11. Mice lacking D5 dopamine receptors have increased sympathetic tone and are hypertensive. PMID: 12486173
  12. Dopamine D5 receptor knockout mice were used to study the role of D5 dopamine receptors in the locomotor-discriminative effects of cocaine. PMID: 12768268
  13. these results confirm and extend the role of the d5 receptor in the modulation of hippocampal acetylcholine release and provide evidence for long-term alteration of hippocampal cholinergic neurotransmission PMID: 15100705
  14. D5 dopamine receptor is found to be expressed in the subcommissural organ (SCO), an ependymal brain gland that is located in the roof of the third ventricle. PMID: 15197646
  15. Dopamine D5 receptor regulates phospholipase D2(PLD2) activity and expression. Hypertension in D5(-/-) mice is associated with increased PLD expression and activity. Impaired D5 receptor regulation of PLD2 may play role in pathogenesis of hypertension. PMID: 15598876
  16. The D(5) receptor mediates discrete topographies of behaviour relating to exploration, and sequential motor coordination; these processes change over the course of interaction with and habituation to the environment. PMID: 15668951
  17. The ability of D5 receptor stimulation to decrease ROS production may explain, in part, the antihypertensive action of D5 receptor activation. PMID: 16352863
  18. the expression and extensive postsynaptic distribution of all known dopamine receptors in spinal cord correspond well with the broad descending dopaminergic projection territory . PMID: 17936519
  19. Dopamine 5 receptor mediates Ang II type 1 receptor degradation via a ubiquitin-proteasome pathway in mice and human cells PMID: 18464932
  20. This review discusses dopamine D5 receptors, which are required for dopamine and selective D(1)-like agonists to induce phospholipase C-mediated phosphoinositide signaling in the mammalian brain. PMID: 19047479
  21. The mRNA level of alpha/beta hydrolase 1 (ABHD1) is significantly upregulated in D5-/- mice. PMID: 19073140
  22. Endogenous dopamine D1/D5 receptor activation decreases NR2A/NR2B ratio of N-methyl-D-aspartate (NMDA) receptor subunit composition at glutamatergic synapses. PMID: 19279248

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1