Recombinant Mouse Frizzled-10 (Fzd10)

Code CSB-CF803892MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Fzd10; Fz10; Frizzled-10; Fz-10; CD antigen CD350
Species
Mus musculus (Mouse)
Expression Region
22-582
Target Protein Sequence
ISSMDLERPGDGKCQPVEIPMCKDIGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCH SHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFKFRWPDSLDCSKLPNK NDPNYLCMEAPNNGSDEPSRGSGMFPPLFRPQRPHSAQEHPLKDGGPGRAGCDNPGKFHH VEKSESCAPLCTPGVDVYWSRDDKRFAVVWLAIWSVLCFFSSAFTVLTFLIDPSRFRYPE RPIIFLSMCYCVYSVGYIIRLFAGAESIACDRDSGQLYVIQEGLESTGCTLVFLVLYYFG MASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDEL TGVCYVGSMDVNALTGFVLVPLACYLVIGTSFILSGFVALFHIRRVMKTGGENTDKLEKL MVRIGVFSLLYTVPATCVIACYFYERLNMDYWKMLATQHKCKMNNQTKTPDCLMTTSIPA VEVFMVKVSMLLVVGITSGVWVWTSKTLQSWQHVCSRGLKRKSRRKPASVVTSAGIYKKA QHPQKPHLGKYELPAQPSACV
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for Wnt proteins. Functions in the canonical Wnt/beta-catenin signaling pathway. The canonical Wnt/beta-catenin signaling pathway leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues (Probable).
Gene References into Functions
  1. the selective expression of FZD10 in brain vascular endothelial cells points at a potential role of FZD10-Galpha13 signalling in central nervous system angiogenesis. PMID: 28126591
  2. Data demonstrate that Wnt7b signals through Fzd1 and -10 and LRP5 and implicate these Wnt coreceptors in the regulation of lung airway and vascular development. PMID: 15923619
  3. Interprets Wnt signals during embryonic mesoderm and neural induction. PMID: 17576136
  4. Frizzled10 expression is very strong during embryonic development of the CNS and may play an essential role in spatial and temporal regulation during neural development. PMID: 19056517
  5. Characterization of the Frizzled10-CreER transgenic mouse: an inducible Cre line for the study of Cajal-Retzius cell development. PMID: 19241378
  6. Results suggest that Frizzed 10 mediates Wnt1 signalling to determine sensory neural differentiation in Xenopus in vivo and in mouse cell culture. PMID: 19716814

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor Fz/Smo family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1