Recombinant Mouse Hydroxycarboxylic acid receptor 2 (Hcar2)

Code CSB-CF866800MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Hcar2; Gpr109; Gpr109a; Gpr109b; Niacr1; Pumag; Hydroxycarboxylic acid receptor 2; G-protein coupled receptor 109; G-protein coupled receptor 109A; G-protein coupled receptor HM74; Niacin receptor 1; Nicotinic acid receptor; Protein PUMA-G
Species
Mus musculus (Mouse)
Expression Region
1-360
Target Protein Sequence
MSKSDHFLVINGKNCCVFRDENIAKVLPPVLGLEFVFGLLGNGLALWIFCFHLKSWKSSR IFLFNLAVADFLLIICLPFLTDNYVHNWDWRFGGIPCRVMLFMLAMNRQGSIIFLTVVAV DRYFRVVHPHHFLNKISNRTAAIISCFLWGLTIGLTVHLLYTNMMTKNGEAYLCSSFSIC YNFRWHDAMFLLEFFLPLAIILFCSGRIIWSLRQRQMDRHAKIKRAINFIMVVAIVFIIC FLPSVAVRIRIFWLLYKYNVRNCDIYSSVDLAFFTTLSFTYMNSMLDPVVYYFSSPSFPN FFSTCINRCLRKKTLGEPDNNRSTSVELTGDPSTTRSIPGALMADPSEPGSPPYLASTSR
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts as a high affinity receptor for both nicotinic acid (also known as niacin) and (D)-beta-hydroxybutyrate and mediates increased adiponectin secretion and decreased lipolysis through G(i)-protein-mediated inhibition of adenylyl cyclase. This pharmacological effect requires nicotinic acid doses that are much higher than those provided by a normal diet. Mediates nicotinic acid-induced apoptosis in mature neutrophils. Receptor activation by nicotinic acid results in reduced cAMP levels which may affect activity of cAMP-dependent protein kinase A and phosphorylation of target proteins, leading to neutrophil apoptosis.
Gene References into Functions
  1. HCA2 plays a critical role in host protection against pro-inflammatory insults. PMID: 28186140
  2. These results demonstrate that GPR109A is functionally expressed in both human and murine islet beta-cells. PMID: 27570060
  3. This study showed that the hypophagia of heat stress is independent of GPR109a, the hepatic vagus afferent nerve, and hepatic ketone body synthesis. PMID: 26936786
  4. Enhanced GPR109a expression in jejunal enterocytes of T2DM mice suggests that GPR109a is involved in elevating intestinal glucose transport observed in diabetes. PMID: 26371038
  5. The expression of GPR109A in pancreatic beta cells is not only influenced by inflammation and glucose, but also plays a protective role under inflammatory conditions. PMID: 26116596
  6. These results suggest that the PKC pathway and PDGFR/EGFR transactivation pathway play important roles in HCA2-mediated Akt activation. PMID: 25375133
  7. Data indicate that GPR109a modulates niacin-induced pancreatic islet dysfunction through activation of the islet beta-cells. PMID: 25622782
  8. Data suggest that expression of Gpr109a is upregulated in adipocytes (intra-abdominal adipose tissue) and macrophages (peritoneal macrophages) during inflammation (models of gram-positive, gram-negative, viral, and fungal infections). PMID: 25320346
  9. HCAR2 activation by dietary or pharmacological means instructs Ly-6C(Lo) monocytes and/or macrophages to deliver a neuroprotective signal to the brain. PMID: 24845831
  10. data indicate that HCA mediates the therapeutic effects of DMF in EAE. PMID: 24691444
  11. GPR109A is a tumor suppressor in mammary gland. PMID: 24371223
  12. role in mediating the beneficial effects of gut microbiota and dietary fiber in colon PMID: 24412617
  13. chronic obesity reduces GPR109A and GPR81 expression in the adipose tissue, while acute in vitro LPS treatment increases expression of GPR109A in adipocytes and macrophages. PMID: 22842580
  14. 0.5-1% niacin in the daily diet activates the mouse GPR109A receptor. PMID: 21774590
  15. Data show that high levels of PUMA-G transcripts and protein were detected in all beta cells. PMID: 21441844
  16. Nicotinic acid inhibits progression of atherosclerosis in mice through its receptor GPR109A expressed by immune cells PMID: 21317532
  17. In conventional mice with normal bacterial colonization of the intestinal tract, GPR109A and SLC5A8 are expressed on the apical membrane of epithelial cells lining the ileum and colon. PMID: 20033346
  18. PUMA-G is highly expressed in adipose tissue and is a nicotinic acid receptor PMID: 12563315
  19. (D)-beta-hydroxybutyrate ((D)-beta-OHB) specifically activates PUMA-G/HM74a at concentrations observed in serum during fasting; (D)-beta-OHB inhibits mouse adipocyte lipolysis in a PUMA-G-dependent manner PMID: 15929991
  20. GPR109A mediates nicotinic acid-induced flushing, an effect which involves release of PGE(2) and PGD(2), most likely from immune cells of the skin PMID: 16322797
  21. Data show that many phenolic acids, including those from the hydroxybenzoic and hydroxycinnamic acid classes, can bind and activate GPR109A (HM74a/PUMA-G), the receptor for the antidyslipidemic agent nicotinic acid. PMID: 19136666
  22. GPR109A receptor plays an important role in the dual regulation of adiponectin secretion and lipolysis PMID: 19141678
  23. studies demonstrated that GPR109A is expressed in retina with its expression restricted to retinal pigment epithelium, where it differentially polarizes to the basolateral membrane PMID: 19223991
  24. the ligand receptor pair 3-OH-octanoic acid/GPR109B mediates a negative feedback regulation of adipocyte lipolysis in human but not in mouse PMID: 19561068

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in lungs, spleen, heart, skeletal muscle and adipose tissue.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1