Recombinant Mouse P2Y purinoceptor 12(P2ry12)

Code CSB-CF861428MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9CPV9
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MDVPGVNTTSANTTFSPGTSTLCVRDYKITQVLFPLLYTVLFFAGLITNSLAMRIFFQIR SKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGAGPLRTLVCQVTSVTFYFTMYISISF LGLITIDRYLKTTRPFKTSSPSNLLGAKILSVVIWAFMFLISLPNMILTNRRPKDKDVTK CSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYSLITKELYRSYVRTRGSAKVPKKKV NVKVFIIIAVFFICFVPFHFARIPYTLSQTRAVFDCSAENTLFYVKESTLWLTSLNACLD PFIYFFLCKSFRNSLTSMLRCSNSTSTSGTNKKKGQEGGEPSEETPM
Source in vitro E.coli expression system
Gene Names P2ry12
Protein Names Recommended name: P2Y purinoceptor 12 Short name= P2Y12
Expression Region 1-347
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for ADP and ATP coupled to G-proteins that inhibit the adenylyl cyclase second messenger system. Required for normal platelet aggregation and blood coagulation.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: mmu:70839

STRING: 10090.ENSMUSP00000051353

UniGene: Mm.422675

Related Products

P2ry12 Proteins

P2ry12 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.