Recombinant Mouse Succinate receptor 1 (Sucnr1)

Code CSB-CF022921MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Sucnr1; Gpr91; Succinate receptor 1; G-protein coupled receptor 91
Species
Mus musculus (Mouse)
Expression Region
1-317
Target Protein Sequence
MAQNLSCENWLATEAILNKYYLSAFYAIEFIFGLLGNVTVVFGYLFCMKNWNSSNVYLFN LSISDFAFLCTLPILIKSYANDKGTYGDVLCISNRYVLHTNLYTSILFLTFISMDRYLLM KYPFREHFLQKKEFAILISLAVWALVTLEVLPMLTFINSVPKEEGSNCIDYASSGNPEHN LIYSLCLTLLGFLIPLSVMCFFYYKMVVFLKRRSQQQATALPLDKPQRLVVLAVVIFSIL FTPYHIMRNLRIASRLDSWPQGCTQKAIKSIYTLTRPLAFLNSAINPIFYFLMGDHYREM LISKFRQYFKSLTSFRT
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for succinate.
Gene References into Functions
  1. Succinate accumulation impairs cardiac pyruvate dehydrogenase activity through GRP91-dependent and independent signaling pathways: Therapeutic effects of ginsenoside Rb1. PMID: 28736181
  2. Succinate functions as an extracellular ligand through binding to its specific receptor on osteoclastic lineage cells and stimulates osteoclastogenesis in vitro and in vivo. Strategies inhibiting Sucnr1 activation inhibit osteoclastogenesis. PMID: 28561074
  3. activation of SUCNR1 in macrophages is important for both infiltration and inflammation of adipose tissue in obesity PMID: 28382382
  4. This study shows that metformin can attenuate activation of HSCs by activating the AMPK pathway and inhibiting the succinate-GPR91 pathway. Metformin has therapeutic potential for treating steatohepatitis and liver fibrosis. PMID: 29278707
  5. This study reports the expression of GPR91 on mouse and human mast cells and reveals a hyperactive behavior of mouse Sucnr1-/- mast cells in a mechanistic in vivo model of skin inflammation. PMID: 27527650
  6. Sucnr1 knockout mice had increased energy expenditure, less white adipose tissue, and improved glucose buffering compared with controls. They became progressively hyperglycemic and failed to secrete insulin. Sucrn1 may be a sensor for dietary energy. PMID: 25352636
  7. These findings suggest that deficiency in SUCNR1 is a possible contributing factor to the pathogenesis of dry age-related macular degeneration. PMID: 23833031
  8. GPR91 is expressed in the retinal pigment epithelium with specific localization to the apical membrane, indicating that succinate in the subretinal space serves as the GPR91 agonist PMID: 21357408
  9. SUCNR1 is located in the luminal membrane of macula densa cells of the juxtaglomerular apparatus in close proximity to renin-producing granular cells, the cortical thick ascending limb, and cortical and inner medullary collecting duct cells. PMID: 19776718
  10. GPR91, a previously orphan G-protein-coupled receptor, functions as a receptor for the citric acid cycle intermediate succinate PMID: 15141213
  11. Release of the prohypertensive hormone renin by the kidney, triggered by high levels of glucose, is mediated by a succinate / GPR91 paracrine signaling cascade in the glomerular endothelium. PMID: 18535668
  12. Macul densa cells can sense alterations in local tissue metabolism via accumulation of tubular succinate and GPR91 signaling. PMID: 19389848

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Predominantly expressed in the kidney (proximal and distal tubules and the juxtaglomerular apparatus). Weakly expressed in liver, spleen and small intestine.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1