Recombinant Mouse Tumor necrosis factor receptor superfamily member 17 (Tnfrsf17)

Code CSB-CF023974MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Tnfrsf17
Uniprot No.
Alternative Names
Tnfrsf17; Bcm; Bcma; Tumor necrosis factor receptor superfamily member 17; B-cell maturation protein; CD antigen CD269
Species
Mus musculus (Mouse)
Expression Region
1-185
Target Protein Sequence
MAQQCFHSEYFDSLLHACKPCHLRCSNPPATCQPYCDPSVTSSVKGTYTVLWIFLGLTLVLSLALFTISFLLRKMNPEALKDEPQSPGQLDGSAQLDKADTELTRIRAGDDRIFPRSLEYTVEECTCEDCVKSKPKGDSDHFFPLPAMEEGATILVTTKTGDYGKSSVPTALQSVMGMEKPTHTR
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.
Gene References into Functions
  1. high affinity antibody blocks the binding of the native ligands APRIL and BAFF to BCMA. This finding is rationalized by the high resolution crystal structure of the Fab fragment in complex with the extracellular domain of BCMA PMID: 25953704
  2. Elimination of B lymphocyte stimulator receptor 3 (BR-3) and BCMA inhibits the development of SLE in NZM mice. PMID: 25989238
  3. we have identified a novel role for BCMA to control excess BAFF production in murine lupus through restraining the accumulation of BAFF-producing neutrophils. PMID: 25010693
  4. Heteromers consisting of one BAFF and two APRIL bind to receptor TACI, BCMA but not to BAFFR. PMID: 25953898
  5. BCMA is dispensable for the development of SLE in NZM mice. BAFF-BCMA interactions contribute to SLE. PMID: 23334904
  6. Study reveals that BCMA works to control B cell homeostasis and self-tolerance in systemic autoimmunity. PMID: 21536804
  7. Blimp-1 is a positive regulator of the expression of BCMA gene in mouse plasma cells. PMID: 20339926
  8. The 5'-flanking sequence from -820 to +145 bp of BCMA is of promoter activity. PMID: 18687216
  9. A vital role of BCMA in bone marrow plasma cell survival. PMID: 14707116
  10. B cell maturation antigen, the receptor for a proliferation-inducing ligand and B cell-activating factor of the TNF family, induces antigen presentation in B cells. PMID: 16116167
  11. Review. APRIL interactions with BCMA likely govern memory B cell populations. PMID: 16919470
  12. Review. Direct BAFF/APRIL signalling in T cells and/or T cell modulation in response to a BAFF-modified B cell compartment may play an important role in inflammation and immunomodulation. PMID: 16931039

Show More

Hide All

Subcellular Location
Membrane; Single-pass type III membrane protein.
Tissue Specificity
Detected in spleen, thymus, bone marrow and heart, and at lower levels in kidney and lung.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1