Recombinant Mouse Tumor necrosis factor receptor superfamily member 9 (Tnfrsf9)

Code CSB-CF023984MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Tnfrsf9; Cd137; Ila; Ly63; Tumor necrosis factor receptor superfamily member 9; 4-1BB ligand receptor; T-cell antigen 4-1BB; CD antigen CD137
Species
Mus musculus (Mouse)
Expression Region
24-256
Target Protein Sequence
VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLTLFLALTSALLLALIFITLLFSVLKWIRKKFPHIFKQPFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.
Gene References into Functions
  1. m4-1BBL and Gal-9 act together to aid aggregation of m4-1BB monomers to efficiently initiate m4-1BB signaling. PMID: 29242193
  2. the CD137-CD137L pathway plays an important role in regulating VSMC phenotype transformation via activation of NFATc1 signaling pathway. PMID: 28770466
  3. Tonic 4-1BB costimulation in chimeric antigen receptors impedes T cell survival and is vector-dependent. PMID: 28978471
  4. fatty acid metabolism plays a crucial role in enhancing the cell cycle progression of anti-CD3-activated CD8(+) T cells in vitro and the anti-apoptotic effects of 4-1BB signaling on these cells. PMID: 26972770
  5. CD137 signaling activates the pro-angiogenic Smad1/5 pathway, induces the phosphorylation of Smad1/5 and nuclear translocation of p-Smad1/5, which in turn promotes the expression and translocation of NFATc1. Blocking CD137 signaling with inhibitory anti-CD137 antibody could inhibit this activation and attenuated agonist anti-CD137 antibody-induced angiogenesis. PMID: 28288971
  6. the role of CD137-CRDI (cysteine rich domain I) in the binding of CD137-CD137L was further investigated. PMID: 27430526
  7. Data indicate that anti-CD137 agonists can function as inhibitors of CD137L signaling, resulting in the creation of tumor microenvironments unfavorable for tumor immune evasion. PMID: 28923858
  8. This study discovers the 4-1BB pathway signaling enhances inflammatory response and promotes pulmonary fibrosis induced by crystalline silica. PMID: 27698940
  9. Constitutive interaction between 4-1BB and 4-1BBL on murine LPS-activated bone marrow dendritic cells masks detection of 4-1BBL by TKS-1 but not 19H3 antibody. PMID: 28789924
  10. results indicate that one important diabetogenic function of CD137 is to promote the expansion and accumulation of beta cell-autoreactive CD8 T cells, and in the absence of CD137 or its interaction with CD137 ligand, type 1 diabetes progression is suppressed PMID: 28363905
  11. High CD137 expression is associated with neoplasms. PMID: 28082401
  12. Ly6C, 4-1BB, and KLRG1 have roles in the activation of lamina propria lymphocytes in the small intestine in a mouse model of Crohn's disease PMID: 28011265
  13. CD137 Regulates NFATc1 Expression in Mouse VSMCs through TRAF6/NF-kappaB p65 Signaling Pathway. PMID: 26600673
  14. 4-1BB triggering preferentially enhances the expansion of CD8+ T cells through the amplification of autocrine IL-2/IL-2R signaling loop. PMID: 25962156
  15. c-IAP ubiquitin protein ligase activity is required for 4-1BB signaling and CD8(+) memory T-cell survival. PMID: 26096449
  16. we conclude that in vivo 4-1BB signaling of myeloid cells negatively regulates peripheral T cell responses PMID: 25601928
  17. activation of CD137 signaling decreases the stability of advanced atherosclerotic plaques via its combined effects on Teff cells, vascular smooth muscle cells, and macrophages PMID: 25059229
  18. 4-1BB mediates the inflammatory responses in obese skeletal muscle by interacting with its ligand 4-1BBL on macrophages. PMID: 24453430
  19. CD137-CD137L interactions mediated via regulation of CyPA contribute to the progression of atherosclerosis. PMID: 24520398
  20. action of agonist anti-4-1BB in suppressing autoimmune and allergic inflammation was completely dependent on Galectin-9 (Gal-9). Gal-9 directly bound to 4-1BB, in a site distinct from the binding site of antibodies and the natural ligand of 4-1BB PMID: 24958847
  21. sCD137 can actively suppress highly purified CD4 T cells in a CD137L dependent fashion. PMID: 24145149
  22. monocytes interact with iNKT cells to increase expression of 4-1BBL and 4-1BB, and in conjunction with this pathway, maintain their numbers at baseline. PMID: 24639347
  23. 4-1BB signaling enhances the proliferation of activated CD8(+) T cells. PMID: 23874982
  24. Results found the activation of CD137L reverse signaling by CD137 resulted in a decrease in cell adhesion to the fibronectin-coated culture basement, thus causing detachment-induced cell death. PMID: 23925549
  25. CD137 plays an essential role in the resolution of acute DSS-induced intestinal inflammation in mice PMID: 24023849
  26. During CD134 plus CD137 dual costimulation, IFN-gamma interacts with IL-2 through distinct mechanisms to program maximal expression of effector molecules in antigen-responding T-cells. PMID: 23295363
  27. Sjogren's syndrome-like autoimmune sialadenitis in MRL-Faslpr mice is associated with expression of glucocorticoid-induced TNF receptor-related protein (GITR) ligand and 4-1BB ligand. PMID: 23301790
  28. Taken together, these data provide evidence that the 4-1BB signal is an important regulator of gammadelta T cells PMID: 23640752
  29. CD137-CD137L interactions increase myelopoiesis during infection PMID: 23519951
  30. 4-1BB/4-1BBL-mediated bidirectional signaling in adipocytes/macrophages promotes adipose inflammation. PMID: 23316108
  31. TRAF1 and LSP1 cooperate downstream of 4-1BB to activate ERK signaling and down-modulate the levels of Bim leading to enhanced T cell survival. PMID: 23446150
  32. The CD137 receptor/ligand system may be a mediator of neuroinflammatory and neurodegenerative disease, by activating microglia which in turn kill oligodendrocytes. PMID: 22799524
  33. Systemic 4-1BB activation induces a novel T cell phenotype driven by high expression of Eomesodermin. PMID: 23547098
  34. 4-1BB signaling plays a role in activating maternal CD8+ T cells from their hypo-responsiveness that are reactive with allogeneic fetal tissue and probably with conventional antigens. PMID: 23029041
  35. CD137L regulates many functions of myelin oligodendrocyte glycoprotein-specific T-cells that contribute to Experimental autoimmune encephalomyelitis PMID: 23238738
  36. After stimulation of total mononuclear cells or CD4+ T cells, surface expression of 4-1BB can be used to detect activated Foxp3+ regulatory T cells (Treg) within a defined window. PMID: 23162126
  37. Results indicate that 4-1BBL/4-1BB contributes to cell survival during antigen-independent IL-2/mAb-complex-dependent T-cell expansion. PMID: 21946662
  38. Data indicate that hypoxia as sensed by the HIF-1alpha system increases expression of CD137 on tumor-infiltrating lymphocytes that become selectively responsive to the immunotherapeutic effects of anti-CD137 agonist monoclonal antibodies. PMID: 22719018
  39. deficiency does not affect development of airway inflammation or respiratory tolerance induction PMID: 22519594
  40. CD137 has a role in breast cancer and its specific antibody can be used to enhance trastuzumab efficacy PMID: 22326955
  41. conditioned medium from Lewis Lung Carcinoma cells caused significant upregulation of 4-1BB in mast cells PMID: 22343053
  42. these data demonstrate that 4-1BB and 4-1BBL do not play a strong or dominant role in driving the generation of high frequencies of vaccinia virus -specific CD8 T cells. PMID: 22037570
  43. The findings suggest that 4-1BB and 4-1BBL may be useful therapeutic targets for combating obesity-induced inflammation and metabolic disorders. PMID: 21998397
  44. the therapeutic outcome of 4-1BB triggering is determined by whether the protective immunity generated against the virus was beneficially altered by the 4-1BB triggering. PMID: 21700476
  45. T-cell co-inhibitory blockade combined with alphaCTLA-4 and active co-stimulation with alpha4-1BB promotes rejection of B16 melanoma in with a vaccine; KLRG1 is a useful marker for monitoring the anti-tumor immune response elicited by this therapy PMID: 21559358
  46. the current study identifies for the first time a specific CD134 plus CD137 costimulatory pathway and an intracellular mechanism relying on Eomesodermin that induces cytotoxic CD4 Th1 cells PMID: 21880986
  47. Membrane and soluble forms of Tnfrsf9 are expressed in specific cell types of the uterus and conceptus during the progression of implantation in mice and possibly have an important function in this process. PMID: 21560035
  48. 4-1BB signaling seems to modulate autoimmune encephalitis by a number of mechanisms, and modulation of the T helper (Th)17 cell versus regulatory T cell (Treg) balance is one of those mechanisms. PMID: 21715692
  49. 4-1BB signaling synergizes with programmed death ligand 1 blockade to augment CD8 T cell responses during chronic viral infection. PMID: 21742975
  50. granulocyte and macrophage populations of murine bone marrow cells are regulated by G-CSF and CD137 protein PMID: 21179444

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed on the surface of activated T-cells.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1