Recombinant Mouse Vasopressin V1a receptor (Avpr1a)

Code CSB-CF737082MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Avpr1a; Vasopressin V1a receptor; V1aR; AVPR V1a; Antidiuretic hormone receptor 1a; Vascular/hepatic-type arginine vasopressin receptor
Species
Mus musculus (Mouse)
Expression Region
1-423
Target Protein Sequence
MSFPRGSHDLPAGNSSPWWPLTTEGANSSREAAGLGEGGSPPGDVRNEELAKLEVTVLAV IFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGP DWLCRVVKHLQVFAMFASSYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAASWGLSFV LSIPQYFIFSVIEFEVNNGTKAQDCWATFIPPWGTRAYVTWMTSGVFVVPVIILGTCYGF ICYHIWRNVRGKTASRQSKGGKGSGEAAGPFHKGLLVTPCVSSVKSISRAKIRTVKMTFV IVSAYILCWTPFFIVQMWSVWDTNFVWTDSENPSTTITALLASLNSCCNPWIYMFFSGHL LQDCVQSFPCCQSIAQKFAKDDSDSMSRRQTSYSNNRSPTNSTGTWKDSPKSSKSIRFIP VST
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system. Involved in social memory formation.
Gene References into Functions
  1. depressive-like behavior alters oxytocin receptor (OxtR) and arginine vasopressin receptor type 1a (AvpR1a) gene expression in the hippocampus (HC) of male mice. PMID: 27525673
  2. The results suggest that vasopressin receptor is required for conditioned effects of an ethanol-associated social stimulus PMID: 26282397
  3. Local over-expression of the AVP receptor V1a enhances regeneration of atrophic muscle. PMID: 24971321
  4. Oxytocin inhibits ASICs through V1A receptors in sensory neurons modulating nociception and pain. PMID: 24641084
  5. Transaortic constriction decreased heart function and betaAR density. It increased V1AR expression. V1AR decreased cardiomyocyte betaAR ligand affinity, betaAR-induced calcium signaling and cAMP in a Gq protein-independent/G protein receptor kinase-dependent way. PMID: 25205804
  6. Using homologous recombination in mice, we reveal the modest contribution of proximal 5' flanking sequences to species differences in V1aR distribution, and confirm that variation in V1aR distribution impacts stress-coping in the forced swim test. PMID: 24009523
  7. Central V1a receptors might play an important role in suppressing baroreflex control of heart rate during cerebral activation at the onset of voluntary locomotion. PMID: 23671158
  8. V1aR signaling may be fundamentally important for the expression of AQP2 in the collecting ducts during control conditions and dehydration PMID: 22968856
  9. Females, but not males, show an orienting bias for odors previously paired with the mother, which is eliminated by V1aR signaling. PMID: 23261858
  10. individual differences in developmentally transient V1aR signaling and even sex may alter the development of excitation and inhibition balance in the neocortex PMID: 22820266
  11. These results suggest that vasopressin directly regulates the nucleocytoplasmic transport of mineralocorticoid receptors via the V1aR in the intercalated cells of the collecting ducts. PMID: 22811487
  12. we do find evidence for the role of V1a receptors in predicting maternal behavior in mice PMID: 22300676
  13. Total elimination of Avpr1a had no effect on fear conditioning in mice PMID: 21668734
  14. Results suggest that variations of estrogen alpha/beta receptor levels are associated with differences in social interaction through the OT and AVP systems, by upregulating gene expression for those peptides and the oxytocin and vasopressin 1a receptors. PMID: 21749489
  15. The V1a receptor (V1aR) for vasopressin, a potent myogenic-promoting factor that stimulates differentiation and hypertrophy in vitro, is expressed in mouse skeletal muscle and modulated during regeneration after experimental injury. PMID: 21816902
  16. Aldosterone requires vasopressin V1a receptors on intercalated cells to mediate acid-base homeostasis. PMID: 21415155
  17. Suggest that the V1aR is involved in the elevation of arterial blood pressure caused by dietary salt and that a V1aR antagonist could have significant therapeutic potential in the treatment of hypertension. PMID: 20118201
  18. Oxytocin-induced analgesia and scratching are mediated by the vasopressin-1A receptor in the mouse. PMID: 20554879
  19. Vasopressin receptor 1a-mediated negative regulation of B cell receptor signaling. PMID: 12576226
  20. The results of this study suggest that the V1aR controls spatial memory in mice. PMID: 15036628
  21. These results demonstrate that the V1aR in the lateral septum plays a critical role in the neural processing of social stimuli required for complex social behavior. PMID: 16102534
  22. Results indicate that the vasopressin V1a receptor plays an important role in normal resting arterial blood pressure regulation mainly by its regulation of circulating blood volume and baroreflex sensitivity. PMID: 16682631
  23. [Arg8]Vasopressin could modulate the lipid metabolism by the antilipolytic action and the synthesis of bile acid via the V1a receptor PMID: 17021052
  24. Avpr1a(-/-) mice have a longer circadian tau and subtle olfactory deficits; however, social aggression, anxiety-like behavior and social recognition are unaffected. PMID: 17083331
  25. V1A receptor in the central nervous system is involved in the regulation of the heart rate via the baroreflex arc. PMID: 17224142
  26. V1aR may be involved in the regulation of social interaction, and V1aR KO mice could be used as an animal model of psychiatric disorders associated with social behavior deficits, such as autism and schizophrenia. PMID: 17227684
  27. one of the AVP-resistance conditions resulting from deficiency of the V1a receptor leads to decreased plasma volume as well as impaired glucose homeostasis, which can progress to obesity under conditions of increased calorie intake PMID: 17303660
  28. Arginine-vasopressin plays a physiological role via the V1a receptor in regulating both protein catabolism and glucose homeostasis. PMID: 17379633
  29. argipressin Avpr1a signaling may play an important role in the preference for ethanol PMID: 18305023
  30. These data indicate that AVP regulates body fluid homeostasis and GFR via the V1aR in MD cells by activating RAS and subsequently the V2R-AQP2 system. PMID: 18448596

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1