Recombinant Mycobacterium bovis CDP-diacylglycerol pyrophosphatase(cdh)

Code CSB-CF508825MVI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. C1AQK4
Storage Buffer Tris-based buffer,50% glycerol
Species Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
Sequence MPKSRRAVSLSVLIGAVIAALAGALIAVTVPARPNRPEADREALWKIVHDRCEFGYRRTG AYAPCTFVDEQSGTALYKADFDPYQFLLIPLARITGIEDPALRESAGRNYLYDAWAARFL VTARLNNSLPESDVVLTINPKNARTQDQLHIHISCSSPTTSAALRNVDTSEYVGWKQLPI DLGGRRFQGLAVDTKAFESRNLFRDIYLKVTADGKKMENASIAVANVAQDQFLLLLAEGT EDQPVAAETLQDHDCSITKS
Source in vitro E.coli expression system
Gene Names cdh
Protein Names Recommended name: CDP-diacylglycerol pyrophosphatase EC= 3.6.1.26 Alternative name(s): CDP-diacylglycerol phosphatidylhydrolase CDP-diglyceride hydrolase
Expression Region 1-260
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Single-pass membrane protein
Protein Families Cdh family
Database Links

KEGG: mbt:JTY_2299

Related Products

cdh Proteins

cdh Proteins for Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.