Recombinant Pig Endothelin-1 receptor (EDNRA)

Code CSB-CF644898PI
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
EDNRA; Endothelin-1 receptor; Endothelin receptor type A; ET-A; ET-AR
Species
Sus scrofa (Pig)
Expression Region
21-427
Target Protein Sequence
DNPESHSTNLSTHVDDFTTFRGTEFSLVVTTHRPTNLALPSNGSMHNYCPQQTKITSAFK YINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFK LLAGRWPFENHDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPL VTAIEIVSIWILSFILAIPEAIGFVMVPFEYKGEEHKTCMLNATSKFMEFYQDVKDWWLF GFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWF PLHLSRILKKTVYDEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCF QSCLCCCCYQSKSLMTSVPMNGTSIQWKNHEQNNHNTERSSHKDSIN
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.
Gene References into Functions
  1. sub-vasomotor concentration of ET-1 leads to vascular dysfunction by impairing endothelium-dependent NO-mediated dilation via p38 kinase-mediated production of superoxide from NADPH oxidase following ETA receptor activation PMID: 26211713
  2. PDE5 inhibition and increase in cGMP produce pulmonary vasodilation that is mediated in part through inhibition of the ET pathway, thereby precluding an additional vasodilator effect of ETA/ETB receptor blockade in the presence of PDE5 inhibition. PMID: 24414253
  3. Blocking ET(A) and ET(B) receptors partially protects sinusoidal circulation and tissue oxygenation against stress induced by high intra-abdominal pressure (IAP). PMID: 22908974
  4. Dual endothelin receptor blockade with tezosentan attenuates hypoxia-induced pulmonary vasoconstriction in porcine model. PMID: 21726419
  5. These results suggest that endothelin released during endotoxemia acts via endothelin A receptors to impair renal medullary blood flow causing ischemia. PMID: 21760895
  6. Anti-endothelin receptor A therapy accelerated the reversal of flow-induced pulmonary arterial disease after flow correction. PMID: 20723731
  7. study suggests a possible role for endothelin-1(resulting from the actions of endothelin-converting enzyme-1) acting via endothelin receptor A in the control of luteolytic sensitivity in the pig PMID: 19783117
  8. Blockade improves renal hemodynamic and function in hypercholesterolemia(HC), and decreases oxidative stress, and renal vascular and tubulointerstitial inflammation and fibrosis. Role for endothelin system in renal injury in HC and atherosclerosis. PMID: 12911546
  9. Results suggest that endothelin A and B receptor protein and mRNA expression is developmentally regulated in the postnatal swine mesenteric artery. PMID: 15240868
  10. Endothelin-A receptor antagonist alters the expression of vasoactive genes and proinflammatory cytokines during hepatic ischemic/reperfusion. PMID: 15838252
  11. Report that inhalation of the endothelin-A receptor antagonist LU-135252 at various doses in experimental acute lung injury improved gas exchange and hemodynamics. PMID: 15838267
  12. ET(A) blockade had no effect on pulmonary vascular resistance at rest or during exercise. PMID: 16709643
  13. PKC and MAPK seem to be involved in the regulation of endothelin type A and type B receptor expression in porcine coronary arteries PMID: 18031734

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Endothelin receptor subfamily, EDNRA sub-subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1