Recombinant Polycystin-2(pkd-2)

Code CSB-CF883324CXY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9U1S7
Storage Buffer Tris-based buffer,50% glycerol
Species Caenorhabditis elegans
Sequence MNYGAADERWANPPQPVAAAEHGPSFDHSMVSEEYEHDKKKNPAQKEGISFSQALLASGH EKSDGKIKLTARSFMEVGGYAVFLIVLVYVAFAQNSIQSYYYSKVMSDLFVASTGASGAP AFGSCTSMDNIWDWLSQVLIPGIYWTETSNSTDNENMIYYENRLLGEPRIRMLKVTNDSC TVMKSFQREIKECFANYEEKLEDKTMVGDGSVDAFIYATAKELENLKTVGTIASYGGGGF VQRLPVAGSTEAQSAIATLKANRWIDRGSRAIIVDFALYNANINLFCVVKLLFELPASGG VITTPKLMTYDLLTYQTSGGTRMMIFEGIFCGFILYFIFEELFAIGRHRLHYLTQFWNLV DVVLLGFSVATIILSVNRTKTGVNRVNSVIENGLTNAPFDDVTSSENSYLNIKACVVFVA WVKVFKFISVNKTMSQLSSTLTRSAKDIGGFAVMFAVFFFAFAQFGYLCFGTQIADYSNL YNSAFALLRLILGDFNFSALESCNRFFGPAFFIAYVFFVSFILLNMFLAIINDSYVEVKA ELARKKDGEGILDWFMNKVRGLTKRGKRPDAPGEDATYEDYKLMLYRAGYAEKDINEAFT RFNVTSMTEHVPEKVAEDIADEVARMTEQKRNYMENHRDYANLNRRVDQMQESVFSIVDR IEGVNATLQTIEKQRVQQQDGGNLMDLSALLTNQVRNRESAARRPTITSIADKKEE
Source in vitro E.coli expression system
Gene Names pkd-2
Protein Names Recommended name: Polycystin-2 Short name= CePc2 Alternative name(s): Polycystic kidney disease 2 protein homolog
Expression Region 1-716
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Functions as a calcium permeable cation channel
Subcellular Location Cell membrane, Multi-pass membrane protein, Cell projection, cilium membrane, Cell projection, cilium, Cell projection, axon, Cell projection, dendrite, Perikaryon, Endoplasmic reticulum membrane
Protein Families Polycystin family
Tissue Specificity Exclusively expressed in a subset of 3 categories of adult male sensory neurons: ray neurons, hook neurons and head cephalic (CEM) neurons (PubMed:10517638, PubMed:11553327, PubMed:12411744, PubMed:15563610, PubMed:16943275, PubMed:16481400). Expressed in
Database Links

KEGG: cel:CELE_Y73F8A.1

STRING: 6239.Y73F8A.1

UniGene: Cel.12535

Related Products

pkd-2 Antibodies

pkd-2 Antibodies for Caenorhabditis elegans

pkd-2 Proteins

pkd-2 Proteins for Caenorhabditis elegans

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.