Recombinant Rat 5-hydroxytryptamine receptor 4 (Htr4)

Code CSB-CF737092RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Htr4; 5-hydroxytryptamine receptor 4; 5-HT-4; 5-HT4; Serotonin receptor 4
Species
Rattus norvegicus (Rat)
Expression Region
1-406
Target Protein Sequence
MDRLDANVSSNEGFGSVEKVVLLTFFAMVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV SLAFADLLVSVLVNAFGAIELVQDIWFYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYY AICCQPLVYRNKMTPLRIALMLGGCWVIPMFISFLPIMQGWNNIGIVDVIEKRKFNHNSN STFCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAQQIQMLQRAGATSESRP QTADQHSTHRMRTETKAAKTLCVIMGCFCFCWAPFFVTNIVDPFIDYTVPEKVWTAFLWL GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYKRPPILGQTVPCSTTTINGSTHVLRD TVECGGQWESRCHLTATSPLVAAQPVIRRPQDNDLEDSCSLKRSQS
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.
Gene References into Functions
  1. Results indicate that visceral nociceptive transmission through the caudal medulla is negatively modulated by descending serotonin type 4 receptor dependent mechanisms. PMID: 28754313
  2. Results support a specific role for 5-HT4-receptors in fine-tuning of the dynamic capacity of hippocampal synapses to express synaptic plasticity. PMID: 26800645
  3. Study suggests a novel role for the 5-HT4 receptor in facilitation of dendrite formation in which intracellular signaling of PKA and the BDNF-TrkB system may be involved. PMID: 27894797
  4. 5-HT4 receptor regulating insulin secretion and acting as a potential drug target in diabetes treatment PMID: 27423314
  5. Increased p11 expression by BDNF and imipramine unraveled a 5-HT4R-mediated modulation of cardiac Ca(2+) handling PMID: 26427584
  6. A novel apical 5-HT4 -mediated bicarbonate secretory pathway and an nitric oxide-dependent inhibitory mechanism are present in the proximal colon PMID: 26061462
  7. Results indicate that 5-HT4 receptors are not synthesized by cholinergic cells, and thus would be absent from cholinergic terminals. Several non-cholinergic cell populations in the basal forebrain and its target express these receptors. PMID: 25183542
  8. Anhedonia, not despair or a decline in exploratory interest, may be associated with upregulation of Let-7a and downregulation of Htr4 expression in the hippocampus; hippocampal Htr4 level may be regulated by Let-7a in rats PMID: 24582667
  9. We conclude that the 5-HT4(a)-receptor may play a more prominent role in the modulation of motor cortico-ponto-cerebellar, cortico-spinal, rubro-spinal, vestibulo-spinal and cortico-nuclear tracts during juvenile development. PMID: 24412663
  10. Activation of 5-HT4 receptors facilitates expression of long-term depression at hippocampal output synapses in acute rat brain slices. PMID: 24505387
  11. the 5-HT(4) receptor is a representative of a foetal cardiac gene program, functional in late foetal development and reactivated in heart failure. PMID: 23029047
  12. Mucosal 5-HT(4) receptor activation can mediate the prokinetic and antinociceptive actions of 5-HT(4)R agonists. PMID: 22226658
  13. beta(1)-AR and 5-HT(4) receptor signalling are subject to opposite regulatory control by cGMP generated by soluble guanylyl cyclase in failing hearts. PMID: 21901315
  14. Up-regulation of 5-HT3 and 5-HT4 receptors expression in the mucosal/submucosal layer is involved to restore the delayed transit after the parasympathetic denervation in rats. PMID: 20691988
  15. Selective activation of 5-HT(4) receptors improved memory performance in an olfactory associative discrimination task in aged rats PMID: 21745655
  16. Study revealed that 5-HT4b, 5-HT2A and 5-HT2B coexisted in auricular myocytes of newborn rat, that 5-HT4 activation reduced cAMP concentration, ICaL and intercellular coupling whereas 5-HT2A or 5-HT2B activation conversely enhanced GJIC. PMID: 19615378
  17. results suggest that 5-HT(4) receptors can modulate GABAergic signalling bidirectionally, depending on the basal PKA activation levels that are determined by neuronal activity PMID: 11986365
  18. results report that serotonin 4(a) receptors are strongly expressed in respiratory Pre-Boetzinger complex neurons and that their selective activation protects spontaneous respiratory activity PMID: 12855812
  19. 5-HT4 receptors located within the cholinergic nucleus basalis magnocellularis may play a role in spatial memory PMID: 14557615
  20. Lysine may be a partial 5-HT4 receptor antagonist and suppresses 5-HT4 receptor-mediated intestinal pathologies and anxiety in rats PMID: 14676321
  21. Construction of benzimidazoles which attach to Htr4 receptor. PMID: 14703122
  22. key role for 5-HT4 receptors in the regulation of synaptic plasticity and the determination of the particular properties of stored synaptic information PMID: 15537670
  23. Positive inotropic response of failing heart to 5-HT(4) stimulation results from increased L-type Ca2+ current/sarcoplamic reticulum Ca(2+) content. PMID: 17660386
  24. These findings point out 5-HT(4) receptor agonists as a putative class of antidepressants with a rapid onset of action. PMID: 17785179
  25. Functional 5-HT(2A) and 5-HT(4) receptors are differentially induced in LV hypertrophy and failure. PMID: 17936780
  26. Serotonin 4a receptors were found predominantly in the neuropilat late embryonic (E18-E20) stages. At birth, expression was predominantly somatic. PMID: 18076058
  27. complete recovery of associative learning performance in the lesioned rats by 5-HT4 receptor agonists PMID: 18485752
  28. 5-HT4 receptor-mediated positive inotropic responses in failing rat ventricle were cAMPdependent. PMID: 18846035

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
In brain, isoform 5-HT4S is restricted to the striatum, but isoform 5-HT4L is expressed throughout the brain, except in the cerebellum. In peripheral tissues, differential expression is also observed in the atrium of the heart where only isoform 5-HT4S is
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1