Recombinant Rat Adenosine receptor A1(Adora1)

Code CSB-CF001375RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P25099
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL KIWNDHFRCQPKPPIDEDLPEEKAED
Source in vitro E.coli expression system
Gene Names Adora1
Protein Names Recommended name: Adenosine receptor A1
Expression Region 1-326
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for adenosine. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Widely expressed in brain and spinal cord.
Database Links

KEGG: rno:29290

STRING: 10116.ENSRNOP00000004602

UniGene: Rn.32078

Pathway cAMP signaling pathway
cGMP-PKG signaling pathway
Sphingolipid signaling pathway

Related Products

Adora1 Proteins

Adora1 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.