Recombinant Rat C-X-C chemokine receptor type 3 (Cxcr3)

Code CSB-CF884915RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Cxcr3; C-X-C chemokine receptor type 3; CXC-R3; CXCR-3; Interferon-inducible protein 10 receptor; IP-10 receptor; CD antigen CD183
Species
Rattus norvegicus (Rat)
Expression Region
1-367
Target Protein Sequence
MYLEVSERQVLDASDIAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDRTFLPVLYS LLFLLGLLGNGAVAAVLLSQRTALSSTDTFLLHLAVADVLLVLTLPLWAVDAAAQWVFGS GLCKVAGALFNINFYAGAFLLACISFDRYLSIVHATQIYRRDPWVRVALTCIVVWGLCVL FALPDFIFLSASHDQRLNATHCQYNFPQVGRTALRVLQLVAGFLMPLLVMAYCYAHILAV LLVSRGQRRFRAMRLVVVVVVAFAVCWTPYHLVVLVDILMDVGVLARNCGRESHVDVAKS VTSGMGYMHCCLNPLLYAFVGVKFKEQMWMLLMRLGRSDQRGPQRQPSSSRRESSWSETT EASYLGL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of mesangial cells through a heterotrimeric G-protein signaling pathway. Binds to CCL21. Probably promotes cell chemotaxis response.
Gene References into Functions
  1. chemokine CXCL10 promotes the development of experimental acute respiratory distress syndrome by binding to its receptor CXCR3 PMID: 28046003
  2. the present study leads to an assumption that CXCL10/CXCR3 signaling mediates inhibition of the corticotropin-releasing factor-stimulated adrenocorticotropin-release by interferon-gamma. PMID: 26572542
  3. The chemokine CXCL12, its truncated form SDF-1(5-67), and the receptors CXCR4 and CXCR3 are expressed in human glaucomatous trabecular tissue and a human trabecular cell line. PMID: 22675496
  4. FK506 suppresses cell proliferation and effecter function, it has less effect on the expression of CCR5 and CXCR3 in lymphocytes. PMID: 21515370
  5. cellular distribution of fractalkine receptor CX3CR1 in the spinal circuit associated with nociceptive transmission supports a potential role in the mechanisms that contribute to the exaggerated pain state in models of neuropathy. PMID: 15341587
  6. Antagonised by various natural products, such as duramycin, roselipins and diosscin. PMID: 15789559
  7. CXCR3/IP-10 signaling is associated with the pathogenesis of experimental autoimmune myasthenia gravis. PMID: 15843529
  8. A novel mechanism is revealed by which CXCR3-expressing CD4 T cells mediate innate immune function that leads to hepatocellular damage during liver ischemia-reperfusion injury. PMID: 16670343
  9. CXCR3 is up-regulated in ischemia-reperfusion injury of liver in rats. PMID: 18589091

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1