Recombinant Rat H-2 class II histocompatibility antigen gamma chain(Cd74)

Code CSB-CF004956RA
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names Cd74
Uniprot No. P10247
Alternative Names Cd74; H-2 class II histocompatibility antigen gamma chain; Ia antigen-associated invariant chain; Ii; MHC class II-associated invariant chain; CD antigen CD74) [Cleaved into: Class-II-associated invariant chain peptide; CLIP)]
Species Rattus norvegicus (Rat)
Expression Region 1-280
Target Protein Sequence MDDQRDLISNHEQLPILGQRARAPESNCNRGVLYTSVSVLVALLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKSAKPVSPMRMATPLLMRPLSMDNMLQAPVKNVTKYGNMTQDHVMHLLTKSGPVNYPQLKGSFPENLKHLKNSMNGLDWKVFESWMKQWLLFEMSKNSLEEKQPTQTPPKVLTKCQEEVSHIPDVHPGAFRPKCDENGNYMPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDPSSGLGVTKQDMGQMFL
Protein Length full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Background

Function
(From Uniprot)
Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place. Enhance also the stimulation of T-cell responses through interaction with CD44.; Binds to the peptide-binding site of MHC class II alpha/beta heterodimers forming an alpha-beta-CLIP complex, thereby preventing the loading of antigenic peptides to the MHC class II complex until its release by HLA-DM in the endosome.; Stabilizes the conformation of mature CTSL by binding to its active site and serving as a chaperone to help maintain a pool of mature enzyme in endocytic compartments and extracellular space of antigen-presenting cells (APCs).
Gene References into Functions
  1. cytokine MIF was able to elicit inflammatory response of astrocytes through interaction with CD74 receptor, and activation of ERK was necessary for the intracellular signal transduction. PMID: 27926507
  2. Methylglyoxal induced gene expression of CD74 in the in the diabetic retina. PMID: 24974304
  3. Macrophage migration inhibitory factor(MIF)/CD74 interaction induces upregulation of cyclooxygenase (COX)-2 and prostaglandin E2 secretion in primary rodent microglia. PMID: 21802455
  4. Data indicate that intraluminal macrophage migration inhibitory factor, released from urothelial cells as a consequence of substance P treatment, interacts with urothelial cell-surface CD74. PMID: 19325914
  5. Intraluminal blockade of cell-surface CD74 and glucose regulated protein 78 prevents substance P-induced bladder inflammatory changes in the rat PMID: 19503733

Show More

Hide All

Subcellular Location [Isoform Long]: Late endosome. Lysosome.; Cell membrane; Single-pass type II membrane protein. Endoplasmic reticulum membrane. Golgi apparatus, trans-Golgi network. Endosome. Lysosome.
Database Links

KEGG: rno:25599

STRING: 10116.ENSRNOP00000025354

UniGene: Rn.33804

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1