Recombinant Rat High affinity immunoglobulin epsilon receptor subunit alpha(Fcer1a)

Code CSB-CF008532RA
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Fcer1a
Uniprot No.
Alternative Names
Fcer1a; Fce1a; High affinity immunoglobulin epsilon receptor subunit alpha; Fc-epsilon RI-alpha; FcERI; IgE Fc receptor subunit alpha
Species
Rattus norvegicus (Rat)
Expression Region
24-245
Target Protein Sequence
ATQKSVVSLDPPWIRILTGDKVTLICNGNNSSQMNSTKWIHNDSISNVKSSHWVIVSATIQDSGKYICQKQGFYKSKPVYLNVMQEWLLLQSSADVVLDNGSFDIRCRSWKKWKVHKVIYYKDDIAFKYSYDSNNISIRKATFNDSGSYHCTGYLNKVECKSDKFSIAVVKDYTIEYRWLQLIFPSLAVILFAVDTGLWFSTHKQFESILKIQKTGKGKKKG
Protein Length
Full Length of Mature Protein
Tag Info
The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Gene References into Functions
  1. Differential Ca(2+) mobilization and mast cell degranulation by FcepsilonRI- and GPCR-mediated signaling has been reported. PMID: 29029788
  2. This study reveals a complex regulation for PLSCR1 tyrosine phosphorylation in FcepsilonRI-activated mast cells, and that PLSCR1 sits at a crossroads between Lyn and Fyn pathways. PMID: 25289695
  3. Data suggest M2PK (M2-type pyruvate kinase) is modulated in mast cell degranulation via IgE/FCERI signaling; immediate inhibition of M2PK involves tyrosine phosphorylation; subsequently fructose-1,6-biphosphate accumulates and activates M2PK. PMID: 24497038
  4. PTP-PEST expression was significantly induced upon FcepsilonRI-crosslinking, and aggregation of FcepsilonRI induced the phosphorylation of PTP-PEST at Ser39, thus resulting in the suppression of PTP activity. PMID: 24791697
  5. NK-1 receptor is required for the activation of RBL-2H3 cells following FcepsilonRIota engagement and involved in the regulation of mitogen-activated protein kinase signaling pathways PMID: 22820943
  6. results reveal intricate functional interactions among different cis-acting elements of IgE receptor in the transcriptional regulation of cox-2. Fyn-->PI 3-kinase-->Akt pathway directly stimulate PMID: 22613973
  7. Data show that among expressed chemokines and cytokines, only CCL2, CCL7 and interleukin (IL)-6 were expressed at higher levels following FcepsilonRI-CCR1 costimulation. PMID: 22417871
  8. These data suggest that CD84 may play a role in modulating Fc epsilon RI-mediated signaling in mast cells. PMID: 18243321
  9. Data show that EGFR, via interaction with FcvarepsilonRI and integrin alpha(5), is necessary for allergic inflammation associated with cellular interaction. PMID: 21349584
  10. In an immunological model, although serial engagement is not required for rat mast cell signaling, it can influence recruitment of Syk kinase to the receptor and subsequent Syk phosphorylation. PMID: 20733205
  11. The spatiotemporal dynamics of the redistribution of immunoglobulin E-loaded receptors (IgE-FcepsilonRI) on rat basophilic leukemia-2H3 mast cells, was quatified. PMID: 20643056
  12. Mast cells produce intercellular connections and that mediators are directionally released upon co-stimulation of FcepsilonRI and CCR1. PMID: 20173038
  13. pineal Fcer1a mRNA levels are controlled by a well described neural pathway PMID: 17728245
  14. Glycosylated FcepsilonRI alpha chain is required for activation of mast cells for IL-4 production by M. pneumoniae. PMID: 18042342
  15. Ca(2+) signaling pathway via a sphingosine kinase (SK) is dependent on clathrin. PMID: 18675457

Show More

Hide All

Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.
Tissue Specificity
Expressed in leukocytes and pinealocytes at night (at protein level).
Database Links
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St., Ste 610, Room 322 (CUBIO Innovation Center), Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1