Product Details

Target Names

Lpar1

Uniprot No.

Alternative Names

Lpar1; Edg2; Gpcr91; Lpa1; Lysophosphatidic acid receptor 1; LPA receptor 1; LPA-1; Lysophosphatidic acid receptor Edg-2

Species

Rattus norvegicus (Rat)

Expression Region

1-364

Target Protein Sequence

MAAASTSSPVISQPQFTAMNEQQCFYNESIAFFYNRSGKYLATEWNTVSKLVMGLGITVC VFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA IPSVGWNCICDIDHCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS RHSSGPRRNRDTMMSLLKTVVIVLGAFIVCWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA EFNSAMNPIIYSYRDKEMSATFRQILCCQRNENPNGPTEGSDRSASSLNHTILAGVHSND HSVV

Protein Length

Full length protein

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Target Background

Function

Receptor for lysophosphatidic acid (LPA). Plays a role in the reorganization of the actin cytoskeleton, cell migration, differentiation and proliferation, and thereby contributes to the responses to tissue damage and infectious agents. Activates downstream signaling cascades via the G(i)/G(o), G(12)/G(13), and G(q) families of heteromeric G proteins. Signaling inhibits adenylyl cyclase activity and decreases cellular cAMP levels. Signaling triggers an increase of cytoplasmic Ca(2+) levels. Activates RALA; this leads to the activation of phospholipase C (PLC) and the formation of inositol 1,4,5-trisphosphate. Signaling mediates activation of down-stream MAP kinases. Contributes to the regulation of cell shape. Promotes Rho-dependent reorganization of the actin cytoskeleton in neuronal cells and neurite retraction. Promotes the activation of Rho and the formation of actin stress fibers. Promotes formation of lamellipodia at the leading edge of migrating cells via activation of RAC1. Through its function as lysophosphatidic acid receptor, plays a role in chemotaxis and cell migration, including responses to injury and wounding. Plays a role in triggering inflammation in response to bacterial lipopolysaccharide (LPS) via its interaction with CD14. Promotes cell proliferation in response to lysophosphatidic acid. Required for normal skeleton development. May play a role in osteoblast differentiation. Required for normal brain development. Required for normal proliferation, survival and maturation of newly formed neurons in the adult dentate gyrus. Plays a role in pain perception and in the initiation of neuropathic pain.

Gene References into Functions

The data suggest that the LPAR1 mutants perturb lysophosphatidic acid signaling in cancer tissues. PMID: 28342860
Results suggest LPA signaling via activation of LPA1 may be necessary for dopamine neuron development and survival PMID: 26169757
These findings indicate lysophosphatidylethanolamine increases intracellular Ca(2+) via a LPA-1/Gi/o proteins/phospholipase C/IP3/Ca(2+) rise/Ca(2+) influx pathway in PC-12 neuronal cells. PMID: 25888792
Conventional protein kinase C alpha and beta isozymes modulate LPA1 receptor phosphorylation state. PMID: 24355769
The LILPA1 in dysplastic lesions and normal epithelium of Cd-treated rats was significantly higher. PMID: 23451264
These results suggest that activation of LPA signaling via mutated LPA(1) may play an important role in the promotion of angiogenesis in rat neuroblastoma cells. PMID: 22580000
The ability of LPA-LPA(1) signaling to promote epithelial cell apoptosis and fibroblast resistance to apoptosis may therefore contribute to the capacity of this signaling pathway to regulate the development of pulmonary fibrosis after lung injury. PMID: 22021336
DNA methylation of the lpa1 gene may be involved in its reduced expression in rat tumor cells PMID: 16970915
IL-1beta inhibits LPA-1 receptor-mediated Rho signaling in astrocytes through the IL-1 receptor, thereby disclosing the LPA-1 receptor-mediated Gi protein/RAC/migration pathway. PMID: 21244430
These results strongly suggest that the LPA-LPA1 receptor signaling pathway plays a role in the induction of bone cancer-related pain PMID: 20553953
Edg2 is expressed in mature oligodendrocytes, shortly before the onset of myelination. PMID: 12139919
nuclear lysophosphatidic acid receptor (LPAR1) type-1 modulates pro-inflammatory gene expression. PMID: 12847111
These results suggest that LPA receptor signaling may play an important role in neuroprotection in retinal ischemia-reperfusion injury. PMID: 17026968
The results demonstrated that mutations in LPA1 gene occur in rat HCCs induced by DEN and the CDAA diet, suggesting that LPA1 mutations may be essentially involved in rat liver carcinogenesis. PMID: 19000703
These results suggest that mutations of LPA1 gene may be involved in the acquisition of growth advantage from adenomas to adenocarcinomas in lung carcinogenesis induced in rats by N-nitrosobis(2-hydroxypropyl)amine . PMID: 19026987

Hide All

Subcellular Location

Cell surface. Cell membrane; Multi-pass membrane protein. Endosome.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Detected in brain corpus callosum, medulla oblongata, cerebellum and sciatic nerve. Detected in heart.

Database Links

KEGG: rno:116744

STRING: 10116.ENSRNOP00000043652

UniGene: Rn.11200

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：

Code	CSB-CF013047RA
MSDS	MSDS
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rat Lysophosphatidic acid receptor 1 (Lpar1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage