Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF012738RA |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | P14562 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Rattus norvegicus (Rat) |
| Sequence | APALFEVKDNNGTACIMASFSASFLTTYDAGHVSKVSNMTLPASAEVLKNSSSCGEKNASEPTLAITFGEGYLLKLTFTKNTTRYSVQHMYFTYNLSDTQFFPNASSKGPDTVDSTTDIKADINKTYRCVSDIRVYMKNVTIVLWDATIQAYLPSSNFSKEETRCPQDQPSPTTGPPSPSPPLVPTNPSVSKYNVTGDNGTCLLASMALQLNITYMKKDNTTVTRAFNINPSDKYSGTCGAQLVTLKVGNKSRVLELQFGMNATSSLFFLQGVQLNMTLPDAIEPTFSTSNYSLKALQASVGNSYKCNSEEHIFVSKALALNVFSVQVQAFRVESDRFGSVEECVQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI |
| Source | in vitro E.coli expression system |
| Gene Names | Lamp1 |
| Protein Names | Recommended name: Lysosome-associated membrane glycoprotein 1 Short name= LAMP-1 Short name= Lysosome-associated membrane protein 1 Alternative name(s): 120 kDa lysosomal membrane glycoprotein Short name= LGP-120 CD107 antigen-like family m |
| Expression Region | 22-407 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | Full Length of Mature Protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Presents carbohydrate ligands to selectins. Also implicated in tumor cell metastasis. |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein, Endosome membrane, Single-pass type I membrane protein, Lysosome membrane, Single-pass type I membrane protein, Late endosome |
| Protein Families | LAMP family |
| Database Links |
KEGG: rno:25328 STRING: 10116.ENSRNOP00000026580 UniGene: Rn.40177 |
| Pathway |
Autophagy
Secreted Extracellular Vesicles |
Lamp1 Proteins for Rattus norvegicus (Rat)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP012738RA1 CSB-EP012738RA1 CSB-BP012738RA1 CSB-MP012738RA1 |
Recombinant Rat Lysosome-associated membrane glycoprotein 1(Lamp1),partial | Yeast E.coli Baculovirus Mammalian cell |
Lamp1 ELISA Kit for Rattus norvegicus (Rat)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL012738RA | Rat Lysosome-associated membrane glycoprotein 1(LAMP1) ELISA kit | serum, plasma,tissue homogenates | 31.25 pg/mL |
Recombinant Human Atrial natriuretic peptide receptor 1(NPR1),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human G1/S-specific cyclin-D2(CCND2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Pyridoxal phosphate phosphatase(Pdxp)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human E3 ubiquitin-protein ligase RBX1(RBX1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Kinesin-like protein KIF1C(Kif1c)
Express system: E.coli
Species: Rattus norvegicus (Rat)
