Recombinant Rat Lysosome-associated membrane glycoprotein 1(Lamp1)

Code CSB-CF012738RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P14562
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence APALFEVKDNNGTACIMASFSASFLTTYDAGHVSKVSNMTLPASAEVLKNSSSCGEKNASEPTLAITFGEGYLLKLTFTKNTTRYSVQHMYFTYNLSDTQFFPNASSKGPDTVDSTTDIKADINKTYRCVSDIRVYMKNVTIVLWDATIQAYLPSSNFSKEETRCPQDQPSPTTGPPSPSPPLVPTNPSVSKYNVTGDNGTCLLASMALQLNITYMKKDNTTVTRAFNINPSDKYSGTCGAQLVTLKVGNKSRVLELQFGMNATSSLFFLQGVQLNMTLPDAIEPTFSTSNYSLKALQASVGNSYKCNSEEHIFVSKALALNVFSVQVQAFRVESDRFGSVEECVQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI
Source in vitro E.coli expression system
Gene Names Lamp1
Protein Names Recommended name: Lysosome-associated membrane glycoprotein 1 Short name= LAMP-1 Short name= Lysosome-associated membrane protein 1 Alternative name(s): 120 kDa lysosomal membrane glycoprotein Short name= LGP-120 CD107 antigen-like family m
Expression Region 22-407
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Presents carbohydrate ligands to selectins. Also implicated in tumor cell metastasis.
Subcellular Location Cell membrane, Single-pass type I membrane protein, Endosome membrane, Single-pass type I membrane protein, Lysosome membrane, Single-pass type I membrane protein, Late endosome
Protein Families LAMP family
Database Links

KEGG: rno:25328

STRING: 10116.ENSRNOP00000026580

UniGene: Rn.40177

Pathway Autophagy
Secreted Extracellular Vesicles

Related Products

Lamp1 Proteins

Lamp1 Proteins for Rattus norvegicus (Rat)

Lamp1 ELISA Kit

Lamp1 ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.