Recombinant Rat Sphingosine 1-phosphate receptor 1 (S1pr1)

Code CSB-CF020650RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
S1pr1; Edg1; Sphingosine 1-phosphate receptor 1; S1P receptor 1; S1P1; Endothelial differentiation G-protein coupled receptor 1; Sphingosine 1-phosphate receptor Edg-1; S1P receptor Edg-1; CD antigen CD363
Species
Rattus norvegicus (Rat)
Expression Region
1-383
Target Protein Sequence
MVSSTSIPVVKALRSQVSDYGNYDIIVRHYNYTGKLNIGVEKDHGIKLTSVVFILICCLI ILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFL REGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNSSRSFLLISACWVISLILGGLPI MGWNCISSLSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRK NISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKAKTCDILYKAEYFLVL AVLNSGTNPIIYTLTNKEMRRAFIRIISCCKCPNGDSAGKFKRPIIPGMEFSRSKSDNSS HPQKDDGDNPETIMSSGNVNSSS
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G-protein coupled receptor for the bioactive lysosphingolipid sphingosine 1-phosphate (S1P) that seems to be coupled to the G(i) subclass of heteromeric G proteins. Signaling leads to the activation of RAC1, SRC, PTK2/FAK1 and MAP kinases. Plays an important role in cell migration, probably via its role in the reorganization of the actin cytoskeleton and the formation of lamellipodia in response to stimuli that increase the activity of the sphingosine kinase SPHK1. Required for normal chemotaxis toward sphingosine 1-phosphate. Required for normal embryonic heart development and normal cardiac morphogenesis. Plays an important role in the regulation of sprouting angiogenesis and vascular maturation. Inhibits sprouting angiogenesis to prevent excessive sprouting during blood vessel development. Required for normal egress of mature T-cells from the thymus into the blood stream and into peripheral lymphoid organs. Plays a role in the migration of osteoclast precursor cells, the regulation of bone mineralization and bone homeostasis. Plays a role in responses to oxidized 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine by pulmonary endothelial cells and in the protection against ventilator-induced lung injury.
Gene References into Functions
  1. There is a marked up-regulation of S1PR1 in hippocampus following traumatic brain injury. PMID: 28018679
  2. maternal lead in the blood affects levels of sphingosine-1-phosphate (S1P) and expression of S1P receptor 1 in the brain of the rat in the perinatal period PMID: 27697711
  3. S1P regulates cell proliferation and angiogenesis via different receptors. PMID: 26543024
  4. The neuronal sphingosine-1-phosphate/S1PR1/STAT3 signalling axis plays a critical role in the control of energy homeostasis. PMID: 25255053
  5. findings identify for the first time the S1P/S1PR1 axis as a promising molecular and therapeutic target in chemotherapy-induced painful peripheral neuropathy, establish a mechanistic insight into the biomolecular signaling pathways PMID: 24876379
  6. We demonstrate that restoration of cardiac plasma membrane levels of S1PR1 produces beneficial effects that counterbalance the deleterious beta1AR overstimulation in heart failure. PMID: 23969695
  7. Data indicate that inhibition of S1PR1 or S1PR3 decreased the velocity of S1P-induced VSMC migration by almost 75%. PMID: 22828274
  8. The S1PR1 receptors in sensory ganglia cells play an important role in regulating behavioral sensitivity during inflammation. PMID: 22445889
  9. The results obtained from the single defined neurons show that S1PR(1) plays a prominent but not exclusive role in the enhancement of neuronal excitability. PMID: 22805346
  10. analysis of quinolinone-based agonists of S1P PMID: 22104144
  11. The sphingosine-1-phosphate (S1P)-to-S1PR-1 pathway is implicated as a downstream signaling pathway in ceramide-induced hyperalgesia. PMID: 21605625
  12. Purification and identification of activating enzymes of CS-0777, a selective sphingosine 1-phosphate receptor 1 modulator, in erythrocytes. PMID: 21613209
  13. FTY720 (Gilenya) phosphate selectivity of sphingosine 1-phosphate receptor subtype 1 (S1P1) G protein-coupled receptor requires motifs in intracellular loop 1 and transmembrane domain 2 PMID: 21719706
  14. Sphingosine 1-phosphate 1 receptor (S1P1R) agonists regulate podocyte-specific proteins PMID: 21289599
  15. These results indicate that S1PR(1) plays a prominent, although not exclusive, role in mediating the enhancement of excitability of sensory neurons. PMID: 20844107
  16. The activation of endothelial S1P(R1) is responsible for the protective action of sphingosine-1-phosphate on microvessel permeability. PMID: 20729401
  17. PKC inhibition therefore may contribute to lymphopenia by down-regulating S1P(1) receptor cell surface expression independently from its activation. PMID: 20032465
  18. This lipid mediator in neural stem/progenitor cell migration may have therapeutic potential in spinal cord injury. PMID: 16990586
  19. These results indicate that CNS S1P receptors are part of a physiologically relevant and widespread neuromodulatory system, and that the S1P(1) receptor contributes to S1P-mediated antinociception. PMID: 19493165

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome. Membrane raft.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1