Recombinant Schizosaccharomyces pombe NADPH--cytochrome P450 reductase(ccr1)

Code CSB-CF018378SXV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P36587
Storage Buffer Tris-based buffer,50% glycerol
Species Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Sequence MKTYEYVLLVIILILSLCYFIYNNFLNKPKAPERRVVATDSIVELMEAEKLTAAVFFGSQTGTAEDFAYRFSTEAKANFNLTNMVFDLENYDLTDLDNFDRSKLLVFFLATYGEGEPTDNAEAFLQLLEGDDTVFSSGKGIEDTPFEGIRYAIFGLGNHTYEYYNAMAKKVDAAMTRLGATRVGNLGLGDDAAGMLEEDYLQWKDDTLPEIGKLFHLQEVHKEYNPMFEVIEKPEISNTSSTVFLGEPSRQQLKGNVASKAPRSQANPFFSSPVRSLELFKSGSRNCLHLELDIADSGMRYQTGDYASICPMNPSQAVDDLLEVLGLKEKRDTVIIVKPIDTLDKAPVLSPTTYDTVFRYYYEICGIVSRQLLSFIAPFAPTPESKQELEKLGNDYDYFKKNVVDLHLNLAQVLRRVSPDAPFTKLPFSMLLENMAHMKPRYYSISSSSVVHPDKVHVTAVVDKKEWTDKNHIFYGLTTNYLLAHCRHMHGEKIPHPNGLEYTLEGPRKNWTGKIPMFVKKSTFRLAPPDVPIIMVGPGTGVAPFRGFVMERANLASKGVKVAKTLLFYGCQYSDKDFLYKEEWQQYKDVLKDSFELITAFSREQDHKIYVQHRLLEHSDTIAKLVEEGAAFYICGDADHMAKDVVNALASILTTVDVDGMKAVKALRDDNRFFEDTW
Source in vitro E.coli expression system
Gene Names ccr1
Protein Names Recommended name: NADPH--cytochrome P450 reductase Short name= CPR Short name= P450R EC= 1.6.2.4
Expression Region 1-678
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This enzyme is required for electron transfer from NADP to cytochrome P450 in microsomes. It can also provide electron transfer to heme oxygenase and cytochrome B5. Involved in ergosterol biosynthesis.
Subcellular Location Endoplasmic reticulum membrane, Single-pass membrane protein, Cytoplasmic side, Mitochondrion outer membrane, Single-pass membrane protein, Cytoplasmic side, Cell membrane, Single-pass membrane protein, Cytoplasmic side
Protein Families NADPH--cytochrome P450 reductase family; Flavodoxin family; Flavoprotein pyridine nucleotide cytochrome reductase family
Database Links

KEGG: spo:SPBC29A10.01

STRING: 4896.SPBC29A10.01.1

Related Products

ccr1 Antibodies

ccr1 Antibodies for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

ccr1 Proteins

ccr1 Proteins for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.