Recombinant Human Fibroblast growth factor 17(FGF17) (Active)

In Stock
Code CSB-AP003851HU
Product Type Growth Factor
Size $137Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. O60258
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alias Fibroblast Growth Factor 17; FGF-17; FGF17
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 15 ug/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT
Research Area Signal Transduction
Source Mammalian cell
Gene Names FGF17
Expression Region 23-216aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 22.64 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. Required for normal brain development.
Involvement in disease Hypogonadotropic hypogonadism 20 with or without anosmia (HH20)
Subcellular Location Secreted
Protein Families Heparin-binding growth factors family
Tissue Specificity Preferentially expressed in the embryonic brain.
Database Links

HGNC: 3673

OMIM: 603725

KEGG: hsa:8822

STRING: 9606.ENSP00000352414

UniGene: Hs.248192

Pathway MAPK signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Ras signaling pathway
Rap1 signaling pathway

Related Products

FGF17 Antibodies

FGF17 Antibodies for Homo sapiens (Human)

FGF17 Antibodies for Human

FGF17 Proteins

FGF17 Proteins for Homo sapiens (Human)

FGF17 ELISA Kit

FGF17 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.