Recombinant Mouse Tumor necrosis factor receptor superfamily member 14(Tnfrsf14),partial

In Stock
Code CSB-AP005311MO
Product Type Immune Checkpoint
Size US$65
Uniprot No. Q80WM9
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias Tnfrsf14; Herpesvirus entry mediator;HVEM; TR2;TNF receptor-like molecule;ATAR;another TRAF-associated receptor;Tumor necrosis factor receptor superfamily member 14
Species Mus musculus (Mouse)
Biological_Activity The ED50 as determined by its ability to bind Human BTLA in functional ELISA is typically 1.17 ug/ml
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQV
Research Area Cancer
Source Mammalian cell
Gene Names Tnfrsf14
Expression Region 39-207aa
Tag Info C-terminal FC-tagged
Mol. Weight 45.6 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.