Recombinant Human Interleukin-4 receptor subunit alpha(IL4R),partial (Active)

In Stock
Code CSB-AP004271HU
Size US$2673Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF?1 human erythroleukemic cells is less than 20 ng/ml.
Target Names IL4R
Uniprot No. P24394
Research Area Immunology
Alternative Names CD124; IL 4R alpha; IL-4 receptor subunit alpha; IL-4-binding protein; IL-4R subunit alpha; IL-4R-alpha; IL-4RA; IL4-BP; Il4r; IL4R nirs variant 1; IL4RA; IL4RA_HUMAN; Interleukin 4 receptor alpha chain; Interleukin 4 receptor; sIL4Ralpha/prot; Soluble IL-4 receptor subunit alpha; Soluble IL-4R-alpha; Soluble interleukin-4 receptor subunit alpha
Species Homo sapiens (Human)
Source Mammalian cell
Expression Region 26-232aa
Complete Sequence MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH
Mol. Weight 24.4 kDa
Protein Length Extracellular Domain
Tag Info C-terminal 6xHis-tagged
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2.
Gene References into Functions
  1. dimerization governed by two-dimensional ligand-receptor interactions with a critical role of the transmembrane domain PMID: 28706306
  2. Interleukin-4 receptor subunit alpha (IL-4Ralpha) haplotypes for Val75Ile, Ser503Pro, and Arg576Gln are associated with measles Immunoglobulin G production in Mozambican children but not Australian children. IL-4Ralpha 503Pro is more prevalent in Mozambique vaccine failure cases compared with controls. PMID: 28594599
  3. We consider that although no association was found among diverse SNPs from human IL-10 and IL-4 promoter regions and gastric cancer event, the present research provides insight into two possible biomarkers of immunological nature (increased level of serum IL-4) and genetic nature (presence of the IL-10, -G1082A SNP) related to this neoplasm in our population. PMID: 30526523
  4. IL4RA and ADAM33 variants may be risk markers of asthma exacerbations in type-2 inflammatory endotype. Precise endotyping may facilitate the identification of genetic risk markers of asthma exacerbations. PMID: 28326636
  5. this study shows that the IL-4Ralpha polymorphism is associated with susceptibility to chronic immune thrombocytopenia PMID: 28511637
  6. Here in this review, we discuss the structural details of IL-4 and IL-4Ralpha subunit and the structural similarities between IL-4 and IL-13. We also describe detailed chemistry of type-I and type-II receptor complexes and their signaling pathways. Furthermore, we elaborate the strength of type-II hetero dimer signals in response to IL-4 and IL-13. PMID: 27165851
  7. Naive CD4+ Tconv cells from subjects with asthma bearing the IL4RR576 mutation show defective induction of iTreg cells and their skewing toward a TH17-like phenotype. PMID: 27479084
  8. Result showed that exposure of Peripheral Blood-Mesenchymal Stem Cells (PB-MSCs) to Noggin was associated with changes in pattern of CD29/CD184 expression. The expression profile of CD29(+/-)/CD184(-) can be suggested as a robust signature for tracing differentiation of PB-MSCs into neuronal cells. PMID: 27478015
  9. The promoter methylation levels of GATA3, IL-4, and TGF-beta were significantly higher in active VKH patients than in healthy individuals PMID: 28278322
  10. A positive association exists between the IL-4R Q551R polymorphism and occurrence of chronic periodontitis. PMID: 28392616
  11. Single nucleotide polymorphism of IL-4Ralpha 175 V was linked to greater Atopic dermatitis risk at 2 to 3 years of age. PMID: 27274543
  12. IL-4Ralpha gene (I50V) polymorphism may play a role in development of eczema among Saudi children PMID: 27018548
  13. genetic polymorphism is associated with autoimmune hepatitis in Brazilian children PMID: 26693492
  14. IL4Rrs2107356 and IL8rs2227307 SNPs were associated with an increased risk of invasive aspergillosis. PMID: 26667837
  15. Essential role of endocytosis for interleukin-4-receptor-mediated JAK/STAT signalling. PMID: 26306492
  16. analysis of IL-4 and IL-13 receptors in cancer biology and discussion of pre-clinical and clinical studies pertaining to recombinant immunotoxins designed to target these receptors [review] PMID: 26088753
  17. review of IL-4 and IL-13 receptor structure, receptor regulation, signaling and experimental therapeutics [review] PMID: 26187331
  18. There is no correlation between the Arg551Gln polymorphism in IL-4R gene and asthma predictive index results PMID: 26695670
  19. Studies indicate significant association between the interleukin-4receptor (IL-4R) Q576R polymorphism and the risk of asthma in the Chinese Han population. PMID: 25867440
  20. Results illustrated that Saudi vitiligo patients showed significantly higher frequency of the IL-4R (Q551R A>G) homozygous GG variant (recessive mode) as compared with their respective controls PMID: 23774696
  21. higher frequency of polymorphisms in patients with familial hypercholesterolemia PMID: 25110223
  22. IL-4RA-1902 A/A genotype has been associated with a reduced response to IL-4 and has been found in 90% oral mucous membrane pemphigoid patient PMID: 23557074
  23. Genetic variants of NOS3, CD14, MMP3 and IL4R are implicated in the determination of VEGF expression and plasma levels. PMID: 26437765
  24. IL4R mediates enhanced glucose and glutamine metabolism in breast cancer cells. PMID: 25746764
  25. Receptor trafficking may play an important role for the regulation of IL-4R-mediated JAK/STAT signaling. PMID: 25468331
  26. Gene interactions were observed between IL4R and TNF-alpha genes in hand osteoarthritis patients. PMID: 25252624
  27. Selective augmentation of IL-4Ralpha signaling in Treg cells induced their reprogramming into Th2-like cells and disease susceptibility towards food allergy. PMID: 25769611
  28. Data show that high expression of interleukin-4 receptor IL-4Ralpha correlated with increased recurrence, while interleukin-13 receptor IL-13Ralpha1 had an inverse relationship to recurrence and survival in oral cavity squamous cell carcinoma patients. PMID: 25483786
  29. Higher TGF-beta with lower CD124 and TSLP, but no difference in PAR-2 expression in bronchial biopsy of bronchial asthma patients in comparison with COPD patients. PMID: 24185116
  30. Analysis of IL4R SNP haplotypes or complex alleles suggested no dominant protection in patients with Recurrent spontaneous abortion PMID: 24803421
  31. Results suggest that the physical interaction between the cytoplasmic domains of IL-13Ralpha2 and IL-4Ralpha regulates IL-4 signaling through the IL-4Ralpha-IL-13Ralpha1 receptor complex. PMID: 24056919
  32. increased expression in B cells of patients with house dust mites allergic asthma PMID: 24975796
  33. The binding of [AP1-V12]6 to cancer cells was remarkably reduced when IL-4 receptors were blocked by antibody against IL-4 receptor further confirmed its binding PMID: 24339977
  34. Increased Th17 cell frequency and poor clinical outcome in rheumatoid arthritis are associated with a genetic variant in the IL4R gene, rs1805010. PMID: 24782180
  35. beta-defensin-2 and interleukin-4 receptor are biomarkers that improve the prediction of poor-outcome over clinical variables in the acute phase of stroke PMID: 24386991
  36. The IL4RA I50V and Q551R polymorphisms may be risk factors for developing asthma. PMID: 23922687
  37. This meta-analysis indicates that the I50V polymorphism of IL-4R gene may confer susceptibility to RA PMID: 23972290
  38. the polymorphism of IL-4Ralpha rs1801275 confers individual's variable susceptibility to glioma, particularly among Asians. PMID: 23979976
  39. Rs1805012 polymorphism of IL-4R gene is associated with asthma. PMID: 24510574
  40. Genetic variants in IL4R were identified, and their association with the progression rate of joint damage in rheumatoid arthritis was independently replicated. PMID: 23983153
  41. Single nucleotide polymorphisms in IL4R gene is associated with the risk of adult glioma. PMID: 23525950
  42. The rs1801275 in IL-4R showed an increased risk of glioblastoma. PMID: 23663500
  43. An meta-analysis suggests that the IL-4Ralpha rs1801275 polymorphism is not a genetic predictor for glioma. PMID: 23395224
  44. reduced IL-4R signalling has stage-specific effects on colorectal carcinogenesis (increased CRC initiation and risk but reduced tumour progression and no effect on CRC mortality). PMID: 23784081
  45. These findings support a pathogenic role for IL-4Ralpha on Th cells following respiratory syncytial virus reinfection PMID: 23543769
  46. Reduced interleukin-4 receptor alpha expression on CD8+ T cells correlates with higher quality anti-viral immunity. PMID: 23383283
  47. Data indicate that single nucleotide polymorphism (SNP) rs1805015 in the IL4Ralpha gene was significantly associated with eczema in the additive and dominant models. PMID: 23480403
  48. Passive smoking causes significant rise in plasma TNFa and IL4 with a dose dependent effect PMID: 23066418
  49. Interacting determinants of atopy, total IgE, IgE against prevalent allergens, and IL4RA polymorphisms, contribute to the high prevalence of betalactams allergy in South of Spain. PMID: 22764749
  50. A protective association for Hodgkin lymphoma was observed on the IL4R gene with haplotype TCA PMID: 22902050
  51. results reveal that IL-4Ralpha may play certain roles in the lipid metabolism of Taiwanese population and suggest a novel link between lipid metabolism and the cytokine receptor PMID: 22633285
  52. A significant association between IL-4R -3223C to T polymorphism and risk of gastric cancer was found. PMID: 22891178
  53. In Korean asthmatic children, increased serum IgE level was a multi-locus interaction between IL-4Ralpha, IL-13, IL-13Ralpha1, CD14, and CTLA4 polymorphisms. The combination of CTLA4/IL-13 and IL-13/IL-13Ralpha1 polymorphisms showed strong synergistic effects. PMID: 22376040
  54. Individuals with IL-4R Ile50Val CT/TT genotypes had a 0.34-fold significantly decreased renal cell cancer risk, and the T variant allele was associated with a decreased risk of RCC in a dose-response manner. PMID: 22317767
  55. This study provides evidence for a significant association of IL-4R (Q551R A/G) genetic polymorphisms with the susceptibility rather than the severity of acne vulgaris PMID: 22705603
  56. Subjects homozygous for the IL4RA rs8832 common G allele randomized to pitrakinra had decreased asthma exacerbations and decreased nocturnal awakenings and activities limited by asthma. PMID: 22541248
  57. we found three protective alleles for glioma patients, including the allele ''G'' of rs1801275 in the IL4R gene by allele model and dominant model analysis PMID: 22369735
  58. reduced responsiveness to interleukin-4 because the I75V polymorphism may contribute to the pathogenesis of myasthenia gravis PMID: 22119518
  59. Tumor expression of IL-4Ralpha is inversely correlated with survival in patients undergoing surgical resection for epithelial MPM. PMID: 22261806
  60. Interactions of the IL-4RA loci may play a role both conferring susceptibility and modulating severity of Atopic dermatitis (AD). PMID: 21918367
  61. Single nucleotide polymorphism in IL4R alpha is associated with asthma susceptibility through gene-gene interactions. PMID: 22355322
  62. IL-4Ralpha polymorphisms were associated with susceptibility to rheumatoid arthritis and may be helpful in early detection of erosive rheumatoid arthritis. PMID: 21497535
  63. there was no significant association of the IL13 and IL4RA polymorphisms with mite-sensitized persistent allergic rhinitis PMID: 22087298
  64. The Q551R IL-4RA polymorphism is a putative risk indicator for severe chronic periodontitis, but was not significant associated to AP. PMID: 21733492
  65. The data provide evidence for codiffusion of IL-4-A647 bound IL-4Ralpha and the type II subunit IL-13Ralpha1 fused to enhanced green fluorescent protein. PMID: 22098734
  66. Transfectants expressing the single nucleotide polymorphism in FCER2 exhibited increased IL-4Ralpha expression after stimulation through CD23 compared with wild-type. PMID: 22059556
  67. Studies indicate that RAD50 and PTPRE of crude associations with asthma at a Bonferroni-corrected level of significance, while IL4R, CCL5 and TBXA2R of nominal significance. PMID: 21734400
  68. IL-4RA Q576R polymorphisms impart a modest yet significant risk for asthma. PMID: 21211370
  69. We found that levels of sIL-4R were strikingly reduced in all forms of TB, particularly meningeal. PMID: 21251883
  70. IL4RA polymorphism may make a modest but significant contribution to a person's genetic susceptibility to chagasic cardiomyopathy. PMID: 21729106
  71. Single nucleotide polymorphisms of CD14, IL-13 and IL-4 receptor are associated with hexamethylene diisocyanate asthma. PMID: 21489615
  72. IL-4R drives dedifferentiation, mitogenesis, and metastasis in rhabdomyosarcoma. PMID: 21536546
  73. The results suggest that the genetic polymorphisms of IL-4R and TGF-beta1 are associated with the risk of colorectal cancer in a Korean population. PMID: 19863607
  74. IL4R SNPs, rs1801275 and rs1805010, are associated with rheumatoid nodules in autoantibody-positive African-American rheumatoid arthritis patients with at least one HLA-DRB1 allele encoding the shared epitope. PMID: 20444266
  75. Data show differences in IL-4/IL-13 receptor subunit expression and responsiveness to IL-4 based on the extent of airway epithelial cell differentiation and suggest that these differences may have functional consequences in airway inflammation. PMID: 20729386
  76. IL4R polymorphisms were associated with asthma in the asthma PMID: 20484924
  77. The Ile50Val polymorphism of IL-4R alpha gene is not associated with bronchial asthma in Han nationality patients. PMID: 17045041
  78. Proliferation appears to be directly mediated via IL4Ralpha on the epithelial tumor cells PMID: 20176658
  79. Variations within the IL4R gene are associated with allergic diseases in children, preferably with eczema and disease phenotypes of ARC and asthma. PMID: 20002627
  80. Data show that flavones inhibited the phosphorylation of STAT6, janus kinase 3, and IL-4Ralpha, whereas IL-4 signaling mediated through type II IL-4R was unaffected by flavones. PMID: 20040389
  81. Significant associations of single nucleotide polymorphisms with wheeze in the past year were detected in only four genes (IL4R, TLR4, MS4A2, TLR9). Variants in IL4R and TLR4 were also related to allergen-specific IgE. PMID: 20085599
  82. Data show that IL-4 receptors are functionally competent in pancreatic beta-cells and that they signal via PI3K and JAK/STAT pathways. PMID: 19531027
  83. 38 single-nucleotide polymorphisms in IL4R were genotyped using the Sequenom iPLEX Gold MassARRAY technology in 2042 multiplex families from nine cohorts. PMID: 19956098
  84. gene-gene interaction in asthma: IL4RA and IL13 in a Dutch population with asthma PMID: 11709756
  85. Tyrosine-phosphorylated IL4R peptides coprecipitate SH2-containing tyrosine phosphatase-1, SH2-containing tyrosine phosphatase-2, and SH2-containing inositol 5'-phosphatase, demonstrating a regulatory role for the ITIM motif in IL-4-induced proliferation. PMID: 11714803
  86. internalization of interleukin 4 receptor alpha increases cytotoxic effect of interleukin 4-receptor-targeted cytotoxin in cancer cells. PMID: 11801567
  87. These results suggest TXA2 receptor polymorphism strongly interacts with IL-4R alpha polymorphism as a major determinant of high serum immunoglobulin E levels in atopic dermatitis. PMID: 11922633
  88. a single gene effect of IL4Ralpha variants or any other gene on chromosome 16 could not be shown in a selected population of children with asthma PMID: 12047364
  89. no evidence for linkage of the IL4R gene locus with sarcoidosis PMID: 12047365
  90. association of haplotype with type 1 diabetes PMID: 12401728
  91. up-regulated 5-fold in B cell chronic lymphocytic leukemia cells, probably leading to increased responsiveness to IL4 and resistance to apoptosis PMID: 12454749
  92. role of Tyr-713 in the interleukin-4 receptor alpha in regulating dephosphorylation of Stat6 PMID: 12459556
  93. Allele frequency of IL4RA polymorphism was associated with rapid decline of lung function in smokers. PMID: 12594065
  94. IL4R is associated with diabetes mellitus, type 1 in Filipinos. PMID: 12748907
  95. Th2 cytokines enhance TARC expression in human airway smooth muscle cells in IL-4Ralpha genotype-dependent fashion. PMID: 12871855
  96. IL-4R alpha chain 576R/R genotypes confer genetic susceptibility to allergic asthma in Chinese. PMID: 12940513
  97. The prevalence of the mutant variant of the IL-4ra gene was lower in neonates with necrotizing enterocolitis (NEC) compared with those without NEC, suggesting that this mutation might protect against the development of NEC in VLBW infants. PMID: 14523823
  98. functional variants within the IL4R gene predispose to hip osteoarthritis in Caucasian females PMID: 14745651
  99. investigated the frequency and genotypes of S503P and Q576R SNPs and their association with traits of allergic asthma in a Hawaii population PMID: 14984008
  100. Certain interstitial pneumonia patients can be modulated in a manner that is dependent on the IL-4 and IL-13 receptor subunit expression by these cells. PMID: 15161635

Show More

Hide All

Subcellular Location Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted
Protein Families Type I cytokine receptor family, Type 4 subfamily
Tissue Specificity Isoform 1 and isoform 2 are highly expressed in activated T-cells.
Database Links

HGNC: 6015

OMIM: 147781

KEGG: hsa:3566

STRING: 9606.ENSP00000170630

UniGene: Hs.513457

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1