Recombinant Human Interleukin-9(IL9) (Active)

In Stock
Code CSB-AP004311HU
Product Type Interleukin
Size $195Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P15248
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias Interleukin-9; IL-9; Cytokine P40; T-Cell Growth Factor P40; IL9
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a cell proliferation assay using MO7e human megakaryocytic leukemic cells is typically less than 0.5 ng/ml
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Research Area Immunology
Source Mammalian cell
Gene Names IL9
Expression Region 19-144aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 15.16 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Supports IL-2 independent and IL-4 independent growth of helper T-cells.
Subcellular Location Secreted
Protein Families IL-7/IL-9 family
Database Links

HGNC: 6029

OMIM: 146931

KEGG: hsa:3578

STRING: 9606.ENSP00000274520

UniGene: Hs.960

Pathway Jak-STAT signaling pathway

Related Products

IL9 Antibodies

IL9 Antibodies for Homo sapiens (Human)

IL9 Antibodies for Human

IL9 Proteins

IL9 Proteins for Homo sapiens (Human)

IL9 ELISA Kit

IL9 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.