Purity

≥ 95% as determined by SDS-PAGE.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human ACVR2A at 2 μg/mL can bind Anti-ACVR2A recombinant antibody (CSB-RA623829MA1HU). The EC50 is 3.848-4.375 ng/mL.

Target Names

ACVR2A

Uniprot No.

P27037 A0A7N9IF81

Alternative Names

Activin receptor type-2A; EC:2.7.11.30; Activin receptor type IIA (ACTR-IIA; ACTRIIA);ACVR2A; ACVR2

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

20-135aa

Target Protein Sequence

AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP

Mol. Weight

14.8 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Activin receptor type-2A mediates TGF-β superfamily signaling that regulates muscle growth, bone homeostasis, and metabolic pathways, making it a target of interest in cachexia and muscular dystrophy research. This mammalian-expressed fragment spanning residues 20–135 captures the extracellular ligand-binding domain and demonstrates quantifiable antibody-binding activity with an EC50 of 3.848–4.375 ng/mL in functional ELISA, providing a validated reagent for competitive inhibition assays and blocking antibody screening campaigns. The measured affinity supports its use in therapeutic antibody epitope mapping, receptor-ligand interaction studies by surface plasmon resonance or biolayer interferometry, and as a positive control in binding assays where reproducible dose-response behavior is essential. Endotoxin levels below 1.0 EU/μg and purity exceeding 95% align with standards expected in cell-based functional assays where low background interference is critical for detecting specific receptor-mediated responses.

Code	CSB-MP001260HU1
Abbreviation	Recombinant Human/Cynomolgus monkey ACVR2A protein, partial (Active)
MSDS	MSDS Datasheet
Size	$110
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human ACVR2A at 2 μg/ml can bind Anti-ACVR2A&ACVR2B recombinant antibody (CSB-RA623829MA1HU). The EC₅₀ is 3.848-4.375 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human/Cynomolgus monkey Activin receptor type-2A (ACVR2A), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

×CloseMessage