Purity

≥ 90% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA.Immobilized Human INHBA(CSB-MP011719HU1b0） at 2 μg/mL can bind Human ACVR2A.The EC50 is 74.75-84.73 ng/mL.

Target Names

ACVR2A

Uniprot No.

P27037 A0A7N9IF81

Alternative Names

Activin receptor type-2A; EC:2.7.11.30; Activin receptor type IIA (ACTR-IIA; ACTRIIA);ACVR2A; ACVR2

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

20-135aa

Target Protein Sequence

AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP

Mol. Weight

42.3 kDa

Protein Length

Partial

Tag Info

C-terminal hFc1-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Activin receptor type-2A mediates signaling by activin and related TGF-β superfamily ligands, making it a critical node in pathways governing muscle homeostasis, metabolism, and immune regulation. This mammalian-expressed construct spanning residues 20–135 captures the extracellular ligand-binding domain and demonstrates quantified binding to immobilized inhibin beta A with an EC50 of 74.75–84.73 ng/mL in functional ELISA, providing a validated basis for ligand-receptor interaction studies and competitive inhibition assays. The C-terminal hFc1 tag facilitates immobilization in surface plasmon resonance and biolayer interferometry experiments, supporting affinity characterization of therapeutic antibodies or small-molecule inhibitors targeting the activin signaling axis. With purity exceeding 90% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for blocking antibody screening and epitope mapping in drug discovery programs focused on metabolic and musculoskeletal disorders.

Code	CSB-MP001260HU1d9
Abbreviation	Recombinant Human/Cynomolgus monkey ACVR2A protein, partial (Active)
MSDS	MSDS Datasheet
Size	$110
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA.Immobilized Human INHBA(CSB-MP011719HU1b0） at 2 μg/ml can bind Human ACVR2A.The EC₅₀ is 74.75-84.73 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human/Cynomolgus monkey Activin receptor type-2A (ACVR2A), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

×CloseMessage