Recombinant Human/Cynomolgus monkey Activin receptor type-2A (ACVR2A), partial (Active)

In Stock
Code CSB-MP001260HU1d9
Abbreviation Recombinant Human/Cynomolgus monkey ACVR2A protein, partial (Active)
MSDS
Size $110
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA.Immobilized Human INHBA(CSB-MP011719HU1b0) at 2 μg/ml can bind Human ACVR2A.The EC50 is 74.75-84.73 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Human INHBA(CSB-MP011719HU1b0) at 2 μg/mL can bind Human ACVR2A.The EC50 is 74.75-84.73 ng/mL.
Target Names
Uniprot No.
Alternative Names
Activin receptor type-2A; EC:2.7.11.30; Activin receptor type IIA (ACTR-IIA; ACTRIIA);ACVR2A; ACVR2
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
20-135aa
Target Protein Sequence
AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP
Mol. Weight
42.3 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Activin receptor type-2A mediates signaling by activin and related TGF-β superfamily ligands, making it a critical node in pathways governing muscle homeostasis, metabolism, and immune regulation. This mammalian-expressed construct spanning residues 20–135 captures the extracellular ligand-binding domain and demonstrates quantified binding to immobilized inhibin beta A with an EC50 of 74.75–84.73 ng/mL in functional ELISA, providing a validated basis for ligand-receptor interaction studies and competitive inhibition assays. The C-terminal hFc1 tag facilitates immobilization in surface plasmon resonance and biolayer interferometry experiments, supporting affinity characterization of therapeutic antibodies or small-molecule inhibitors targeting the activin signaling axis. With purity exceeding 90% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for blocking antibody screening and epitope mapping in drug discovery programs focused on metabolic and musculoskeletal disorders.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*