Recombinant Human/Cynomolgus Activin receptor type-2B (ACVR2B), partial (Active)

In Stock
Code CSB-MP623829HU
Abbreviation Recombinant Human ACVR2B protein, partial (Active)
MSDS
Size $98
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human ACVR2B at 2 μg/ml can bind Anti-ACVR2A&ACVR2B recombinant antibody (CSB-RA623829MA1HU). The EC50 is 2.983-3.438 ng/mL. Biological Activity Assay
  • The purity of ACVR2B was greater than 90% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human ACVR2B at 2 μg/mL can bind Anti-ACVR2B recombinant antibody (CSB-RA623829MA1HU). The EC50 is 2.983-3.438 ng/mL.
Target Names
Uniprot No.
Alternative Names
Activin receptor type-2B; EC:2.7.11.30; Activin receptor type IIB (ACTR-IIB); ACVR2B
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
19-137aa
Target Protein Sequence
SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLT
Mol. Weight
15.0 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human ACVR2B protein is expressed from HEK293 cells with a 10xHis tag at the C-terminus. It contains Ser19-Thr137 of the human ACVR2B protein. Its purity is up to 95% as determined by SDS-PAGE and SEC-HPLC. Its biological activity is confirmed in a functional ELISA, where immobilized human ACVR2B at 2 μg/mL can bind the anti-ACVR2B recombinant antibody (CSB-RA623829MA1HU), with the EC50 of 2.983-3.438 ng/mL.

The human ACVR2B protein plays a critical role in various biological processes, primarily through its involvement in the TGF-β signaling pathway. This receptor is essential for mediating the effects of several ligands, including activins and myostatin, which are pivotal in regulating muscle growth and differentiation, as well as other physiological functions.

ACVR2B mainly regulates muscle mass. It acts as a receptor for myostatin, a negative regulator of muscle growth. Studies have shown that ACVR2B binds myostatin with high affinity, and its inhibition can lead to significant increases in muscle mass, comparable to the effects observed in myostatin knockout models [1][2]. The blockade of ACVR2B signaling has been demonstrated to preserve skeletal muscle in various contexts, including cancer cachexia and disuse atrophy [3][4][5]. Specifically, the use of soluble forms of ACVR2B, such as ACVR2B-Fc, has shown promise in counteracting muscle wasting induced by chemotherapy [5][6].

ACVR2B is also implicated in bone metabolism. It has been identified as a high-affinity receptor for activin A and bone morphogenetic proteins (BMPs), which are crucial for osteogenic differentiation [7][8]. The ACVR2B signaling pathway can inhibit osteogenic differentiation, indicating that ACVR2B plays a dual role in both muscle and bone homeostasis [7][8]. Inactivation of ACVR2B has been proposed as a therapeutic target for conditions characterized by muscle and bone loss, such as osteoporosis and cachexia [6][7].

Moreover, ACVR2B is involved in immune responses and tissue remodeling. Activin A, which signals through ACVR2B, has been linked to various immune functions, including macrophage polarization and responses in allergic diseases [8][9].

References:
[1] S. Lee, A. Lehar, C. Ly, Q. Pham, M. Michaud, R. Rydzik, et al. Functional redundancy of type i and type ii receptors in the regulation of skeletal muscle growth by myostatin and activin a, Proceedings of the National Academy of Sciences, vol. 117, no. 49, p. 30907-30917, 2020. https://doi.org/10.1073/pnas.2019263117
[2] A. Windelinckx, G. Mars, W. Huygens, M. Peeters, B. Vincent, C. Wijmenga, et al. Comprehensive fine mapping of chr12q12-14 and follow-up replication identify activin receptor 1b (acvr1b) as a muscle strength gene, European Journal of Human Genetics, vol. 19, no. 2, p. 208-215, 2010. https://doi.org/10.1038/ejhg.2010.173
[3] T. Li, R. Wu, Y. Zhang, & D. Zhu. A systematic analysis of the skeletal muscle mirna transcriptome of chicken varieties with divergent skeletal muscle growth identifies novel mirnas and differentially expressed mirnas, BMC Genomics, vol. 12, no. 1, 2011. https://doi.org/10.1186/1471-2164-12-186
[4] K. Murphy, V. Cobani, J. Ryall, C. Ibebunjo, & G. Lynch. Acute antibody-directed myostatin inhibition attenuates disuse muscle atrophy and weakness in mice, Journal of Applied Physiology, vol. 110, no. 4, p. 1065-1072, 2011. https://doi.org/10.1152/japplphysiol.01183.2010
[5] T. Nissinen, J. Degerman, M. Räsänen, A. Poikonen, S. Koskinen, E. Mervaala, et al. Systemic blockade of acvr2b ligands prevents chemotherapy-induced muscle wasting by restoring muscle protein synthesis without affecting oxidative capacity or atrogenes, Scientific Reports, vol. 6, no. 1, 2016. https://doi.org/10.1038/srep32695
[6] R. Barreto, Y. Kitase, T. Matsumoto, F. Pin, K. Colston, K. Couch, et al. Acvr2b/fc counteracts chemotherapy-induced loss of muscle and bone mass, Scientific Reports, vol. 7, no. 1, 2017. https://doi.org/10.1038/s41598-017-15040-1
[7] L. Barrault, J. Gide, T. Qing, L. Lesueur, J. Tost, J. Denis, et al. Expression of mirnas from the imprinted dlk1/dio3 locus signals the osteogenic potential of human pluripotent stem cells, Cells, vol. 8, no. 12, p. 1523, 2019. https://doi.org/10.3390/cells8121523
[8] O. Olsen, K. Wader, H. Hella, A. Mylin, I. Turesson, I. Nesthus, et al. Activin a inhibits bmp-signaling by binding acvr2a and acvr2b, Cell Communication and Signaling, vol. 13, no. 1, 2015. https://doi.org/10.1186/s12964-015-0104-z
[9] K. Tengvall, E. Sundström, C. Wang, K. Bergvall, O. Wallerman, E. Pederson, et al. Bayesian model and selection signature analyses reveal risk factors for canine atopic dermatitis, Communications Biology, vol. 5, no. 1, 2022. https://doi.org/10.1038/s42003-022-04279-8

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*