Purity

≥ 95% as determined by SDS-PAGE.
≥ 90% as determined by SEC-HPLC.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human ACVR2B at 2 μg/mL can bind Anti-ACVR2B recombinant antibody (CSB-RA623829MA1HU). The EC50 is 2.983-3.438 ng/mL.

Target Names

ACVR2B

Uniprot No.

Q13705 A0A2K5WUB0

Alternative Names

Activin receptor type-2B; EC:2.7.11.30; Activin receptor type IIB (ACTR-IIB); ACVR2B

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

19-137aa

Target Protein Sequence

SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLT

Mol. Weight

15.0 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Activin receptor type-2B mediates signaling by activins and related TGF-β superfamily ligands, playing critical roles in muscle homeostasis, metabolism, and bone remodeling, making its extracellular domain a key target for therapeutic antibody development and ligand interaction studies. This mammalian-expressed fragment spanning residues 19–137 captures the ligand-binding domain with native post-translational modifications that support proper folding, as demonstrated by functional ELISA where immobilized protein binds a recombinant anti-ACVR2A/2B antibody with an EC50 of 2.983–3.438 ng/mL. The quantified binding affinity provides a validated basis for competitive inhibition assays, blocking antibody screening, and therapeutic antibody epitope mapping experiments where precise receptor-antibody interaction kinetics are essential. Purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg align with standards expected in surface plasmon resonance, biolayer interferometry, and cell-based receptor occupancy assays.

Code	CSB-MP623829HU
Abbreviation	Recombinant Human/Cynomolgus monkey ACVR2B protein, partial (Active)
MSDS	MSDS Datasheet
Size	$98
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human ACVR2B at 2 μg/ml can bind Anti-ACVR2A&ACVR2B recombinant antibody (CSB-RA623829MA1HU). The EC₅₀ is 2.983-3.438 ng/mL. Biological Activity Assay The purity of ACVR2B was greater than 90% as determined by SEC-HPLC
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human/Cynomolgus monkey Activin receptor type-2B (ACVR2B), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

×CloseMessage