Purity

≥ 95% as determined by SDS-PAGE.
≥ 95% as determined by SEC-HPLC.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA.Immobilized Human INHBA(CSB-MP011719HU1b0) at 2 μg/mL can bind Human ACVR2B.The EC50 is 45.93-52.42 ng/mL.

Target Names

ACVR2B

Uniprot No.

Q13705 A0A2K5WUB0

Alternative Names

Activin receptor type-2B; EC:2.7.11.30; Activin receptor type IIB (ACTR-IIB); ACVR2B

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

19-137aa

Target Protein Sequence

SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLT

Mol. Weight

43.6 kDa

Protein Length

Partial

Tag Info

C-terminal hFc1-Flag-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Activin receptor type-2B mediates signaling by activin and related TGF-β superfamily ligands, making it a critical node in pathways governing muscle homeostasis, metabolism, and bone remodeling. This mammalian-expressed extracellular domain (residues 19–137) demonstrates quantified binding to immobilized human inhibin βA with an EC50 of 45.93–52.42 ng/mL in functional ELISA, providing a validated basis for ligand-receptor interaction studies, competitive inhibition assays, and blocking antibody screening campaigns. The measured affinity supports its use as a positive control in binding platforms including surface plasmon resonance and biolayer interferometry, as well as in therapeutic antibody epitope mapping where native glycosylation and tertiary structure are essential for physiologically relevant epitope presentation. Dual SDS-PAGE and SEC-HPLC purity exceeding 95%, combined with endotoxin levels below 1.0 EU/μg, aligns with standards expected in drug discovery workflows targeting activin–ACVR2B interactions for muscle-wasting and metabolic disorders.

Code	CSB-MP623829HUi9
Abbreviation	Recombinant Human/Cynomolgus monkey ACVR2B protein, partial (Active)
MSDS	MSDS Datasheet
Size	$98
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA.Immobilized Human INHBA(CSB-MP011719HU1b0) at 2 μg/ml can bind Human ACVR2B.The EC₅₀ is 45.93-52.42 ng/mL. Biological Activity Assay The purity of ACVR2B was greater than 95% as determined by SEC-HPLC
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human/Cynomolgus monkey Activin receptor type-2B (ACVR2B), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

×CloseMessage