Code | CSB-MP006920HU(A4) |
Size | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
This Human DKK1 recombinant protein was produced in mammalian cell, where the gene sequence encoding Human DKK1 (32-266aa) was expressed with the C-terminal 10xHis tag. The purity of this DKK1 protein was greater than 95% by SDS-PAGE. The activity was validated. DKK1 (Dickkopf-related protein 1), a member of the DKK family (including DKK1, DKK2, DKK3, DKK4), was first discovered in Xenopus laevis, also known as Dickkopf-1, Dkk-1. It can regulate Xenopus head development by inhibiting Wnt/β-catenin signaling pathway, so it is regarded as a classic inhibitor. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized Human DKK1 at 2 μg/mL can bind Anti-DKK1 recombinant antibody (CSB-RA006920MA1HU), the EC50 is 1.283-2.544 ng/mL. |
Target Names | DKK1 |
Uniprot No. | O94907 |
Research Area | Cardiovascular |
Alternative Names | (Dickkopf-1)(Dkk-1)( hDkk-1)(SK) |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 32-266aa |
Target Protein Sequence | TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH |
Mol. Weight | 28.5 kDa |
Protein Length | Full Length of Mature Protein |
Tag Info |
C-terminal 10xHis-tagged |
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. Inhibits the pro-apoptotic function of KREMEN1 in a Wnt-independent manner, and has anti-apoptotic activity.
|
Gene References into Functions |
|
Subcellular Location | Secreted. |
Protein Families | Dickkopf family |
Tissue Specificity | Placenta. |
Database Links |
HGNC: 2891 OMIM: 605189 KEGG: hsa:22943 STRING: 9606.ENSP00000363081 UniGene: Hs.40499 |