Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human DKK1 at 2 μg/mL can bind Anti-DKK1 recombinant antibody (CSB-RA006920MA1HU), the EC50 is 1.283-2.544 ng/mL.
Research Area
Cardiovascular
Alternative Names
(Dickkopf-1)(Dkk-1)( hDkk-1)(SK)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
32-266aa
Target Protein Sequence
TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Human DKK1 recombinant protein was produced in mammalian cell, where the gene sequence encoding Human DKK1 (32-266aa) was expressed with the C-terminal 10xHis tag. The purity of this DKK1 protein was greater than 95% by SDS-PAGE. The activity was validated.
DKK1 (Dickkopf-related protein 1), a member of the DKK family (including DKK1, DKK2, DKK3, DKK4), was first discovered in Xenopus laevis, also known as Dickkopf-1, Dkk-1. It can regulate Xenopus head development by inhibiting Wnt/β-catenin signaling pathway, so it is regarded as a classic inhibitor.
The Wnt signaling pathway is one of the most classic and important signaling pathways in cell signaling pathways, and it is widely involved in the processes of cell proliferation, apoptosis, cell migration and angiogenesis. DKK1 is an important regulator of the Wnt signaling pathway. There are two ways for DKK1 to inhibit the Wnt/β-catenin signaling pathway. One is that DKK1 competitively binds to LRP5/6 to prevent the formation of the complex, resulting in the blockage of the Wnt pathway; the other is that DKK1 interacts with the single-channel transmembrane protein (Krm1) /Krm2 and LRP5/6/ combine with each other to form a ternary complex. This complex undergoes rapid endocytosis, leading to clearance of LRP5/6 from the plasma membrane, and LRP5/6 cannot interact with Wnt ligands, thereby inhibiting the Wnt/β-catenin signaling pathway.