Product Details

Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

≤10 EU/mg by the LAL method

Activity

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is ≤0.01 ng/mL.

Target Names

EPO

Uniprot No.

P01588

Alternative Names

Erythropoietin; Epoetin; EPO

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

28-193aa

Target Protein Sequence

APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Mol. Weight

18.3 kDa

Protein Length

Full Length of Mature Protein

Tag Info

Tag free

Form

Lyophilized
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Erythropoietin drives red blood cell production through high-affinity engagement of the EPO receptor, and this recombinant form demonstrates potent bioactivity with an ED50 ≤0.01 ng/mL in TF-1 erythroleukemic cell proliferation assays, confirming receptor-binding competence at sub-picomolar concentrations. Expressed in mammalian cells to preserve the native N-glycosylation essential for in vivo stability and receptor activation, the protein spans residues 28–193, representing the full-length mature form that circulates physiologically. This low ED50 supports use in cell proliferation and survival assays, stem cell differentiation studies targeting erythroid lineages, and receptor-ligand binding experiments including ELISA and surface plasmon resonance. Purity exceeding 95% by SDS-PAGE and endotoxin levels ≤10 EU/mg align with standards expected in sensitive primary cell cultures and antibody characterization workflows.

Code	CSB-MP007743HU-WD
Abbreviation	Recombinant Human EPO protein (Active)
MSDS	MSDS Datasheet
Size	Inquiry
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Erythropoietin (EPO) (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage