Product Details

Purity

≥ 90% as determined by SDS-PAGE.

Activity

①The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 0.3534 to 0.7096 ng/mL.
②Measured by its binding ability in a functional ELISA.Immobilized Human EPO at 2 μg/mL can bind Anti-EPO recombinant antibody (CSB-RA007743MA1HU).The EC50 is 0.4354-0.5532 ng/mL.

Target Names

EPO

Uniprot No.

P01588

Alternative Names

Erythropoietin; Epoetin

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

28-193aa

Target Protein Sequence

APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Mol. Weight

21.2 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Erythropoietin drives red blood cell production by binding the EPO receptor on erythroid progenitors, and recombinant forms with authentic glycosylation are essential for assays that depend on receptor engagement and downstream signaling. This mammalian-expressed protein, spanning the full mature sequence (aa 28–193), demonstrates dose-dependent proliferation of TF-1 cells with an ED50 of 0.35–0.71 ng/mL, confirming receptor-mediated bioactivity suitable for cell survival assays and hematopoietic differentiation studies. The same preparation binds an anti-EPO recombinant antibody in functional ELISA with an EC50 of 0.44–0.55 ng/mL, supporting its use in receptor-ligand competition assays, antibody characterization panels, and as a quantitative ELISA standard. Purity exceeding 90% by SDS-PAGE and endotoxin below 1.0 EU/μg align with standards expected in sensitive proliferation and binding experiments where contaminants can confound dose-response curves.

Code	CSB-MP007743HU
Abbreviation	Recombinant Human EPO protein (Active)
MSDS	MSDS Datasheet
Size	$116
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity The ED₅₀ as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 0.3534 to 0.7096 ng/mL. Biological Activity Assay Activity Measured by its binding ability in a functional ELISA.Immobilized Human EPO at 2 μg/mL can bind Anti-EPO recombinant antibody (CSB-RA007743MA1HU).The EC50 is 0.4354-0.5532 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Erythropoietin (EPO) (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage