Product Details

Purity

≥ 95% as determined by SDS-PAGE.
≥ 95% as determined by SEC-HPLC.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human GIPR at 2 μg/mL can bind Anti-GIPR recombinant antibody (CSB-RA009438MA1HU). The EC50 is 16.18-18.70 ng/mL.

Target Names

GIPR

Uniprot No.

P48546

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

22-138aa

Target Protein Sequence

RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ

Mol. Weight

16.2 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

GIPR, a class B G protein-coupled receptor, mediates glucose-dependent insulinotropic polypeptide signaling and represents a therapeutic target in metabolic disease research. This mammalian-expressed fragment spanning residues 22–138 captures the extracellular ligand-binding domain, where native glycosylation and disulfide bonding are critical for antibody recognition and ligand interaction studies. Functional ELISA validation demonstrates specific binding to an anti-GIPR recombinant antibody with an EC50 of 16.18–18.70 ng/mL, confirming that the protein retains conformational epitopes required for therapeutic antibody screening, competitive inhibition assays, and epitope mapping experiments. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this fragment provides a suitable basis for surface plasmon resonance affinity characterization, biolayer interferometry kinetic studies, and blocking antibody validation in drug discovery workflows targeting incretin receptor pathways.

Target Background

Function

This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Gene References into Functions

an association between the GIPR rs2302382 polymorphism and type 2 diabetes mellitus in Egyptian patients. PMID: 28744963
Data suggest that GIPR (gastric inhibitory polypeptide receptor) is among the few GPCRs (G-protein-coupled receptors) which signal through G-proteins (GTP-binding protein Gs alpha subunit, here) both at plasma membrane and in endosomes; recombinant proteins expressed in HEK293 cells were used in these studies. PMID: 27641811
GIPR overexpression does not appear to affect acromegalic patients' clinical features PMID: 28179449
Study shows the internalization of GIPR involving clathrin-coated pits, AP-2 and dynamin and its subsequent intracellular trafficking. GIP stimulates a rapid robust internalization of the GIPR, the major part being directed to lysosomes. PMID: 26225752
The common variant rs10423928 in the GIPR gene is associated with increased risk of stroke in patients with type 2 diabetes. PMID: 26395740
Body mass index change for the A/T+A/A in GIPR genotypes was significantly higher than that for the T/T genotype. rs10423928 may predict weight gain in schizophrenia. PMID: 25321336
The potential future role of gastric inhibitory peptide (GIP) receptors as molecular targets in neuroendocrine neoplasms may be dependent on the tumor grade. PMID: 25591947
Results show that GIPR undergoes trafficking between the plasma membrane and intracellular compartments of both GIP-stimulated and unstimulated adipocytes. PMID: 25047836
GIPR is overexpressed in gastric and duodenal neuroendocrine tumors PMID: 24565507
GIPR expression was downregulated in subcutaneous adipose tissue from obese patients and correlated negatively with body mass index, waist circumference, systolic blood pressure, and glucose and triglyceride levels. PMID: 24512489
GIPR promoter was hypomethylated in type 2 diabetic patients as compared to controls. PMID: 24086540
This study demonstrates an association between a functional GIPR polymorphism Glu354Gln (rs1800437) and Bone mineral density and fracture risk. PMID: 24446656
Compared with the current treatment standard SSTR2, GIPR has only somewhat lesser absolute gene expression in tumor tissue but much lesser expression in normal tissue, making it a promising new target for neuroendocrine tumor imaging and therapy. PMID: 24238043
Structural and pharmacological characterization of novel potent and selective monoclonal antibody antagonists of glucose-dependent insulinotropic polypeptide receptor. PMID: 23689510
Functional expression of a GIP receptor mutant lacking N-glycosylation is rescued by co-expressed wild type GLP1 receptor, which suggests formation of a GIP-GLP1 receptor heteromer. PMID: 22412906
Our prospective, observational study indicates that the type 2 diabetes risk by dietary intake of carbohydrate and fat may be dependent on GIPR genotype. PMID: 22399504
Most of the somatostatin receptor-negative neuroendocrine tumors and GLP-1 receptor-negative malignant insulinomas are GIP receptor positive. PMID: 22112810
The T allele of GIPR rs2287019 is associated with greater improvement of glucose homeostasis in individuals who choose a low-fat, high-carbohydrate, and high-fiber diet. PMID: 22237064
a role of the adipocyte GIPr in nutrient-dependent regulation of body weight and lean mass, but it does not support a direct and independent role for the adipocyte or beta-cell GIPr in promoting adipogenesis. PMID: 22027838
Variations of the GIPR sequence are not associated with childhood obesity. PMID: 20516203
Variants at the GIPR locus associated with 2-h glucose level (rs10423928, beta (s.e.m.) = 0.09 (0.01) mmol/l per A allele, P = 2.0 x 10(-15)), were identified. PMID: 20081857
Proximal 5' flanking region is TATA-less and contains a GC-rich region involved in cellular expression. PMID: 12530665
differences in cellular response to gastric inhibitory polypeptide(GIP) mediated by endothelin-1 may be related to differences in activation of GIP receptor splice variants PMID: 12721154
Glucose-stimulated insulin secretion is maintained despite complete absence of both GIP-1 and GIP receptors. Role for incretin receptors as essential downstream targets for glucoregulatory actions of DPP-IV inhibitors. PMID: 15111503
Proximal promoter of GIP-R gene contains a GC-rich region capable of binding to Sp1 and SP3. PMID: 15666829
the promoter region of the GIP-R gene revealed six consensus sequences important in regulating the reporter gene activity and capable of binding to Sp1 and Sp3 transcription factors PMID: 16087722
GIPR adipose tissue gene expression was significantly lower in insulin resistant obese non-diabetic women PMID: 17395281
GIPR overexpression was observed in pediatric and adult adrenocortical tumors PMID: 18971217
Diabetic kidney lesions of GIPRdn transgenic mice: podocyte hypertrophy and thickening of the GBM precede glomerular hypertrophy and glomerulosclerosis. PMID: 19211686
Our data suggest a potential relevance of GIPR variants for obesity. PMID: 19254363
Decreased TCF7L2 protein levels in type 2 diabetes mellitus correlate with downregulation of GLP-1R and GIP-R. PMID: 19386626

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 2 family

Database Links

HGNC: 4271

OMIM: 137241

KEGG: hsa:2696

STRING: 9606.ENSP00000467494

UniGene: Hs.251412

Code	CSB-MP009438HU1d7
Abbreviation	Recombinant Human GIPR protein, partial (Active)
MSDS	MSDS Datasheet
Size	$9.9
Promotion
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human GIPR at 2μg/mL can bind Anti-GIPR recombinant antibody (CSB-RA009438MA1HU)，the EC₅₀ is 16.18-18.70 ng/mL. Biological Activity Assay The purity of GIPR was greater than 95% as determined by SEC-HPLC
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Gastric inhibitory polypeptide receptor(GIPR),partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage