Recombinant Human Gastric inhibitory polypeptide receptor(GIPR),partial (Active)

In Stock Promotion
Code CSB-MP009438HU1d7
Abbreviation Recombinant Human GIPR protein, partial (Active)
MSDS
Size $136
Order now
Promotion
20% OFF Promotion on CUSABIO Premium Active Proteins
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human GIPR at 2μg/mL can bind Anti-GIPR recombinant antibody (CSB-RA009438MA1HU),the EC50 is 16.18-18.70 ng/mL. Biological Activity Assay
  • The purity of GIPR was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human GIPR at 2 μg/mL can bind Anti-GIPR recombinant antibody (CSB-RA009438MA1HU). The EC50 is 16.18-18.70 ng/mL.
Target Names
Uniprot No.
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
22-138aa
Target Protein Sequence
RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ
Mol. Weight
16.2 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.
Description

To generate the recombinant human GIPR protein, the target gene encoding amino acids 22-138 of the human GIPR is expressed in mammalian cells using a plasmid system. The target gene is co-expressed with the C-terminal 10xHis-tag gene. The resulting GIPR protein's purity is up to 95% as determined by SDS-PAGE and SEC-HPLC. Its endotoxin level measured via the LAL method is less than 1.0 EU/μg. ELISA confirms the GIPR protein's biological activity through specific GIPR recombinant antibody (CSB-RA009438MA1HU) binding, with an EC50 of 16.18 to 18.70 ng/mL.

The human GIPR, also known as the glucose-dependent insulinotropic polypeptide receptor, is a GPCR that plays a crucial role in glucose metabolism and insulin secretion. GIPR is primarily activated by the incretin hormone gastric inhibitory polypeptide (GIP), which is secreted by K cells in the duodenum and proximal small intestine in response to nutrient ingestion, particularly carbohydrates and fats [1][2][3]. Upon activation, GIPR enhances insulin secretion from pancreatic β-cells, thereby contributing to the regulation of blood glucose levels [2][4].

Research has indicated that GIPR has implications for obesity and type 2 diabetes mellitus (T2DM). GIPR signaling has been linked to improved insulin sensitivity and lipid metabolism, which are critical in the context of obesity [5][6]. Furthermore, genetic variations in the GIPR gene have been associated with impaired glucose homeostasis and obesity phenotypes, suggesting a complex role of GIPR in metabolic disorders [7][4].

GIPR is also involved in various physiological processes beyond glucose regulation. It is expressed in several tissues, including adipose tissue and bone, where it influences bone cell metabolism and remodeling [8][9]. Studies have shown that GIPR is present in osteoblastic cell lines, indicating a potential role in bone health and metabolism [8][9]. Moreover, GIPR has been identified as a promising target for therapeutic interventions in neuroendocrine tumors, highlighting its relevance in cancer biology [10][11].

References:
[1] Y. Takahashi. Gastric inhibitory polypeptide receptor antagonism suppresses intramuscular adipose tissue accumulation and ameliorates sarcopenia, Journal of Cachexia Sarcopenia and Muscle, vol. 14, no. 6, p. 2703-2718, 2023. https://doi.org/10.1002/jcsm.13346
[2] S. Yamane and N. Harada. Gastric inhibitory polypeptide/glucose‐dependent insulinotropic polypeptide signaling in adipose tissue, Journal of Diabetes Investigation, vol. 10, no. 1, p. 3-5, 2018. https://doi.org/10.1111/jdi.12942
[3] Y. Yamada, K. Tsukiyama, T. Sato, T. Shimizu, H. Fujita, & T. Narita. Novel extrapancreatic effects of incretin, Journal of Diabetes Investigation, vol. 7, no. S1, p. 76-79, 2016. https://doi.org/10.1111/jdi.12495
[4] S. Erfanian, H. Mir, A. Abdoli, & A. Roustazadeh. Association of gastric inhibitory polypeptide receptor (gipr) gene polymorphism with type 2 diabetes mellitus in iranian patients, BMC Medical Genomics, vol. 16, no. 1, 2023. https://doi.org/10.1186/s12920-023-01477-z
[5] P. Mróz, B. Finan, V. Gelfanov, B. Yang, M. Tschöp, R. DiMarchi, et al. Optimized gip analogs promote body weight lowering in mice through gipr agonism not antagonism, Molecular Metabolism, vol. 20, p. 51-62, 2019. https://doi.org/10.1016/j.molmet.2018.12.001
[6] H. Kizilkaya, K. Sørensen, C. Kibsgaard, L. Gasbjerg, A. Hauser, A. Sparre-Ulrich, et al. Loss of function glucose-dependent insulinotropic polypeptide receptor variants are associated with alterations in bmi, bone strength and cardiovascular outcomes, Frontiers in Cell and Developmental Biology, vol. 9, 2021. https://doi.org/10.3389/fcell.2021.749607
[7] J. Sauber, J. Grothe, M. Behm, A. Scherag, H. Grallert, T. Illig, et al. Association of variants in gastric inhibitory polypeptide receptor gene with impaired glucose homeostasis in obese children and adolescents from berlin, Acta Endocrinologica, vol. 163, no. 2, p. 259-264, 2010. https://doi.org/10.1530/eje-10-0444
[8] M. Hansen, M. Tencerova, J. Frølich, M. Kassem, & M. Frost. Effects of gastric inhibitory polypeptide, glucagon‐like peptide‐1 and glucagon‐like peptide‐1 receptor agonists on bone cell metabolism, Basic & Clinical Pharmacology & Toxicology, vol. 122, no. 1, p. 25-37, 2017. https://doi.org/10.1111/bcpt.12850
[9] E. Aoyama, I. Watari, K. Podyma‐Inoue, M. Yanagishita, & T. Ono. Expression of glucagon-like peptide-1 receptor and glucose-dependent insulinotropic polypeptide receptor is regulated by the glucose concentration in mouse osteoblastic mc3t3-e1 cells, International Journal of Molecular Medicine, vol. 34, no. 2, p. 475-482, 2014. https://doi.org/10.3892/ijmm.2014.1787
[10] S. Sherman, J. Carr, D. Wang, M. O'Dorisio, T. O'Dorisio, & J. Howe. Gastric inhibitory polypeptide receptor (gipr) is a promising target for imaging and therapy in neuroendocrine tumors, Surgery, vol. 154, no. 6, p. 1206-1214, 2013. https://doi.org/10.1016/j.surg.2013.04.052
[11] A. Haase. Gastric inhibitory polypeptide receptor (gipr) overexpression reduces the tumorigenic potential of retinoblastoma cells, Cancers, vol. 16, no. 9, p. 1656, 2024. https://doi.org/10.3390/cancers16091656

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene References into Functions
  1. an association between the GIPR rs2302382 polymorphism and type 2 diabetes mellitus in Egyptian patients. PMID: 28744963
  2. Data suggest that GIPR (gastric inhibitory polypeptide receptor) is among the few GPCRs (G-protein-coupled receptors) which signal through G-proteins (GTP-binding protein Gs alpha subunit, here) both at plasma membrane and in endosomes; recombinant proteins expressed in HEK293 cells were used in these studies. PMID: 27641811
  3. GIPR overexpression does not appear to affect acromegalic patients' clinical features PMID: 28179449
  4. Study shows the internalization of GIPR involving clathrin-coated pits, AP-2 and dynamin and its subsequent intracellular trafficking. GIP stimulates a rapid robust internalization of the GIPR, the major part being directed to lysosomes. PMID: 26225752
  5. The common variant rs10423928 in the GIPR gene is associated with increased risk of stroke in patients with type 2 diabetes. PMID: 26395740
  6. Body mass index change for the A/T+A/A in GIPR genotypes was significantly higher than that for the T/T genotype. rs10423928 may predict weight gain in schizophrenia. PMID: 25321336
  7. The potential future role of gastric inhibitory peptide (GIP) receptors as molecular targets in neuroendocrine neoplasms may be dependent on the tumor grade. PMID: 25591947
  8. Results show that GIPR undergoes trafficking between the plasma membrane and intracellular compartments of both GIP-stimulated and unstimulated adipocytes. PMID: 25047836
  9. GIPR is overexpressed in gastric and duodenal neuroendocrine tumors PMID: 24565507
  10. GIPR expression was downregulated in subcutaneous adipose tissue from obese patients and correlated negatively with body mass index, waist circumference, systolic blood pressure, and glucose and triglyceride levels. PMID: 24512489
  11. GIPR promoter was hypomethylated in type 2 diabetic patients as compared to controls. PMID: 24086540
  12. This study demonstrates an association between a functional GIPR polymorphism Glu354Gln (rs1800437) and Bone mineral density and fracture risk. PMID: 24446656
  13. Compared with the current treatment standard SSTR2, GIPR has only somewhat lesser absolute gene expression in tumor tissue but much lesser expression in normal tissue, making it a promising new target for neuroendocrine tumor imaging and therapy. PMID: 24238043
  14. Structural and pharmacological characterization of novel potent and selective monoclonal antibody antagonists of glucose-dependent insulinotropic polypeptide receptor. PMID: 23689510
  15. Functional expression of a GIP receptor mutant lacking N-glycosylation is rescued by co-expressed wild type GLP1 receptor, which suggests formation of a GIP-GLP1 receptor heteromer. PMID: 22412906
  16. Our prospective, observational study indicates that the type 2 diabetes risk by dietary intake of carbohydrate and fat may be dependent on GIPR genotype. PMID: 22399504
  17. Most of the somatostatin receptor-negative neuroendocrine tumors and GLP-1 receptor-negative malignant insulinomas are GIP receptor positive. PMID: 22112810
  18. The T allele of GIPR rs2287019 is associated with greater improvement of glucose homeostasis in individuals who choose a low-fat, high-carbohydrate, and high-fiber diet. PMID: 22237064
  19. a role of the adipocyte GIPr in nutrient-dependent regulation of body weight and lean mass, but it does not support a direct and independent role for the adipocyte or beta-cell GIPr in promoting adipogenesis. PMID: 22027838
  20. Variations of the GIPR sequence are not associated with childhood obesity. PMID: 20516203
  21. Variants at the GIPR locus associated with 2-h glucose level (rs10423928, beta (s.e.m.) = 0.09 (0.01) mmol/l per A allele, P = 2.0 x 10(-15)), were identified. PMID: 20081857
  22. Proximal 5' flanking region is TATA-less and contains a GC-rich region involved in cellular expression. PMID: 12530665
  23. differences in cellular response to gastric inhibitory polypeptide(GIP) mediated by endothelin-1 may be related to differences in activation of GIP receptor splice variants PMID: 12721154
  24. Glucose-stimulated insulin secretion is maintained despite complete absence of both GIP-1 and GIP receptors. Role for incretin receptors as essential downstream targets for glucoregulatory actions of DPP-IV inhibitors. PMID: 15111503
  25. Proximal promoter of GIP-R gene contains a GC-rich region capable of binding to Sp1 and SP3. PMID: 15666829
  26. the promoter region of the GIP-R gene revealed six consensus sequences important in regulating the reporter gene activity and capable of binding to Sp1 and Sp3 transcription factors PMID: 16087722
  27. GIPR adipose tissue gene expression was significantly lower in insulin resistant obese non-diabetic women PMID: 17395281
  28. GIPR overexpression was observed in pediatric and adult adrenocortical tumors PMID: 18971217
  29. Diabetic kidney lesions of GIPRdn transgenic mice: podocyte hypertrophy and thickening of the GBM precede glomerular hypertrophy and glomerulosclerosis. PMID: 19211686
  30. Our data suggest a potential relevance of GIPR variants for obesity. PMID: 19254363
  31. Decreased TCF7L2 protein levels in type 2 diabetes mellitus correlate with downregulation of GLP-1R and GIP-R. PMID: 19386626

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family
Database Links

HGNC: 4271

OMIM: 137241

KEGG: hsa:2696

STRING: 9606.ENSP00000467494

UniGene: Hs.251412

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*