Recombinant Human Gastric inhibitory polypeptide receptor(GIPR),partial

Code CSB-MP009438HU1
Product Type Recombinant Protein
Size US$1848
Uniprot No. P48546
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ
Research Area Others
Source Mammalian cell
Gene Names GIPR
Protein Names Recommended name: Gastric inhibitory polypeptide receptor Short name= GIP-R Alternative name(s): Glucose-dependent insulinotropic polypeptide receptor
Expression Region 22-138aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 18.5
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 2 family
Database Links

HGNC: 4271

OMIM: 137241

KEGG: hsa:2696

STRING: 9606.ENSP00000467494

UniGene: Hs.251412

Pathway cAMP signaling pathway

Related Products

GIPR Antibodies

GIPR Antibodies for Homo sapiens (Human)

GIPR Antibodies for Human

GIPR Proteins

GIPR Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.