Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human MYL9 at 2 μg/mL can bind Anti-MYL9 recombinant antibody (CSB-RA015318MA1HU), the EC50 is 4.628-6.430 ng/mL.

Target Names

MYL9

Uniprot No.

P24844

Alternative Names

20 kDa myosin light chain; LC20; MLC-2C; Myosin RLC; Myosin regulatory light chain 2, smooth muscle isoform; Myosin regulatory light chain 9; Myosin regulatory light chain MRLC1

Species

Homo sapiens (Human)

Source

Yeast

Expression Region

2-172aa

Target Protein Sequence

SSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD

Mol. Weight

21.7kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant human MYL9 protein is generated in a yeast expression system. Through the integration of the human MYL9 gene fragment (2-172aa) linked to a C-terminal 10xHis-tag gene into a plasmid vector, the construct is introduced into mammalian cells. Subsequent cell culture facilitates effective protein synthesis. The protein's purity, exceeding 95%, is validated via SDS-PAGE analysis, and its endotoxin levels, below 1.0 EU/ug, are confirmed using the LAL method. The protein's functionality is demonstrated by its interaction with MYL9 recombinant antibody (CSB-RA015318MA1HU), with the EC₅₀ of 4.628-6.430 ng/mL.

MYL9 is a regulatory light chain of myosin, playing a crucial role in various biological processes such as cell contraction, proliferation, and invasion. The MYL9 gene exhibits abnormal expression in various malignancies, including lung cancer, breast cancer, prostate cancer, malignant melanoma, and other tumor types. Moreover, this altered expression is often closely associated with poor prognosis. Serving as both a molecular marker and a potential target, MYL9 holds significant clinical value in early diagnosis, prognosis prediction, and targeted therapy of malignant tumors. Therefore, the preparation of MYL9 protein could facilitate the development and research of clinical drugs targeting MYL9.

Target Background

Function

Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion. In myoblasts, may regulate PIEZO1-dependent cortical actomyosin assembly involved in myotube formation.

Gene References into Functions

MYL9 expression might be a promising prognostic marker and therapeutic target in ESCC PMID: 28388691
At the cleavage furrow Arv1 recruits myosin heavy chain 9 (MYH9) and myosin light chain 9 (MYL9) by interacting with IQ-motif-containing GTPase-activating protein (IQGAP1). PMID: 27104745
These findings suggested that low MYLK and MYL9 expressions might be associated with the development of NSCLC. PMID: 25179839
the decreased expression of MYL9 may play an important role in tumor progression of prostate cancer PMID: 24338276
Overexpression of MRTF-A significantly promoted the migration of MCF-7 cells through its transactivation effects on MYL9 and CYR61 genes PMID: 24084383
Overexpression of SMYD3 promotes MRTF-A-mediated upregulation of MYL9 and migration of MCF-7 breast cancer cells PMID: 24189459
surface CD3 expression proceeds through both MYL9-dependent and MYL9-independent pathways (i.e. the protein kinase C- dependent pathway) in Jurkat cells. PMID: 23538510
The FHC-mediated structural perturbations in RLC that affect Ca(2+) binding properties of mutated myocardium are responsible for triggering the abnormal function of the heart that in turn might initiate a hypertrophic process and lead to heart failure. PMID: 16076902
Smooth muscle type isoform, MLC-2C, is the inducible isoform, and might play a crucial role in monocyte/macrophage cell lineage. PMID: 18480596
use of a shRNA to decrease MYL9 expression showed that MYL9 was involved in proplatelet formation PMID: 19724058

Hide All

Subcellular Location

Cytoplasm, cytoskeleton. Cytoplasm, cell cortex.

Tissue Specificity

Smooth muscle tissues and in some, but not all, nonmuscle cells.

Database Links

HGNC: 15754

OMIM: 609905

KEGG: hsa:10398

STRING: 9606.ENSP00000279022

UniGene: Hs.504687

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：

Code	CSB-YP015318HU
Size	$436
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human MYL9 at 2μg/mL can bind Anti-MYL9 recombinant antibody (CSB-RA015318MA1HU)，the EC₅₀ is 4.628-6.430 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Myosin regulatory light polypeptide 9(MYL9) (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage